Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g3499.t1
Gene name
Locationscaffold_016:122279..125551
Strand+
Gene length (bp)3272
Transcript length (bp)1725
Coding sequence length (bp)1725
Protein length (aa) 575

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03878 YIF1 YIF1 2.2E-99 71 334
PF01929 Ribosomal_L14e Ribosomal protein L14 1.8E-27 482 557
PF00467 KOW KOW motif 4.6E-06 441 471

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0005840 ribosome Yes
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043603 cellular amide metabolic process No
GO:0043604 amide biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0048193 Golgi vesicle transport No
GO:0043226 organelle No
GO:0006810 transport No
GO:0016020 membrane No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0044249 cellular biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0051649 establishment of localization in cell No
GO:0044260 cellular macromolecule metabolic process No
GO:0051641 cellular localization No
GO:0043229 intracellular organelle No
GO:0043228 non-membrane-bounded organelle No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0031090 organelle membrane No
GO:0006518 peptide metabolic process No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0009058 biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0005198 structural molecule activity No
GO:0016192 vesicle-mediated transport No
GO:0009059 macromolecule biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 173 192 19
2 202 224 22
3 237 259 22
4 263 285 22
5 321 340 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g3499.t1
MYRQSFAPPPAQSPPLHHPVPQHVSTVPMMRSPPPPASQQPQTSGYGNPYQPAPAQGGSGTYAPGFGGFINDPTA
QMGFQVGKTAMAAGQEYMEQNFNRYVSIPALKHYFNVSNSYVLNKLSLVLFPWRHKPWSRQQARLTTASTGPNGQ
ISQQQYSSMFLPPRDDLNSPDMYIPVMALVTYILLSAMLAGFRGNFHPELLGSITTTAIAVILFEIMCLKLAMYI
LSINNESQLLDLVAYSGYKFVGIIVTLLTSEILTPGRGTGGWVGWVVFIYTFLANAFFLLRSLKYVLLPDSTSDA
SMRTGSMHTVARSQRNRRTQFLFIYSYVIQFVFINPGEGFTDTGSIANYRIISLVELTLGRTQTPLGGLLLAAKR
DSCGRRAAAPKFAIQQTRATCAFRTTSTTRHFDNKLSTPSSRSLSTEAFAMADIDVQVAQWKLVEVGRVVLIRSG
PYTGKLAAIVEIVDHKRVLVDGPSTEEQKIVPRHVLPLSHATLTHFVIPRLPRAAGTGPVKKLWQKEEIDGKWAK
SNFAQKTERAERRKNLSDFERFKVLRLRKQARYEVQKAHAKLRAAAPKS*
Coding >Ani_SJS100_1|g3499.t1
ATGTACCGCCAGTCGTTCGCTCCACCCCCAGCGCAGTCCCCTCCCCTTCACCATCCTGTGCCTCAGCATGTCTCG
ACCGTCCCCATGATGCGCTCGCCGCCGCCTCCGGCATCACAACAGCCTCAGACTTCTGGCTATGGCAACCCATAC
CAGCCCGCCCCTGCGCAGGGTGGCAGCGGAACCTATGCTCCTGGCTTCGGGGGGTTCATCAATGATCCCACCGCG
CAGATGGGATTCCAGGTCGGAAAGACCGCCATGGCAGCTGGACAGGAATATATGGAGCAGAACTTCAATCGCTAT
GTCTCTATACCAGCTCTAAAGCACTATTTCAACGTCTCGAATTCTTACGTCCTGAACAAATTGTCCCTCGTTCTC
TTCCCTTGGCGGCACAAACCCTGGTCCCGTCAACAGGCGCGTCTTACAACAGCTTCAACTGGTCCCAATGGCCAG
ATATCCCAGCAGCAGTACTCTTCCATGTTCCTCCCTCCGCGCGATGATCTCAACTCTCCAGACATGTATATCCCC
GTCATGGCACTTGTCACATACATCCTTCTCTCAGCGATGTTGGCCGGATTCCGCGGTAACTTCCATCCGGAGCTG
CTTGGTTCAATTACTACTACTGCTATCGCTGTCATACTGTTCGAGATAATGTGCTTGAAGCTGGCCATGTACATC
CTCAGCATCAACAACGAGTCACAGCTGCTGGATTTGGTAGCATATTCGGGATACAAGTTTGTCGGCATCATCGTC
ACTTTGTTGACATCTGAGATCCTCACTCCGGGCCGAGGAACCGGCGGCTGGGTTGGCTGGGTCGTCTTCATTTAC
ACCTTCCTTGCTAATGCCTTCTTTCTGCTCCGTTCTCTGAAATACGTTCTGCTCCCGGACTCCACAAGTGATGCA
TCCATGCGCACTGGTTCTATGCACACGGTTGCTCGCTCGCAGCGTAACCGTCGCACCCAGTTCCTGTTCATCTAC
TCGTACGTTATCCAGTTCGTGTTCATAAACCCCGGCGAGGGCTTCACAGACACTGGGTCAATCGCAAATTACCGC
ATCATCTCCCTGGTGGAGTTAACCCTAGGCCGCACGCAAACGCCCCTGGGTGGGCTGCTACTGGCTGCTAAGCGA
GACTCTTGTGGGCGAAGGGCCGCAGCACCGAAATTCGCTATCCAGCAGACCAGAGCGACTTGTGCGTTTCGGACG
ACTTCGACAACCCGACATTTCGACAACAAATTATCAACACCGTCCTCCCGGAGTCTGTCGACCGAAGCCTTCGCC
ATGGCCGATATCGATGTTCAGGTTGCTCAATGGAAGCTGGTTGAGGTTGGCCGCGTTGTGCTGATCCGCAGCGGT
CCTTACACCGGCAAGCTCGCTGCCATTGTTGAGATTGTCGACCACAAGCGTGTCTTGGTCGACGGTCCCTCCACC
GAGGAGCAGAAGATCGTTCCCCGCCACGTCCTTCCTCTCTCCCACGCCACCCTCACTCACTTCGTCATCCCCCGT
TTGCCCCGTGCTGCCGGTACTGGCCCCGTGAAGAAGCTTTGGCAGAAGGAGGAGATCGATGGCAAGTGGGCCAAG
TCCAACTTCGCCCAGAAGACCGAGCGCGCTGAGCGCAGGAAGAACCTGTCCGACTTCGAGCGCTTCAAGGTCCTC
CGCCTCCGGAAGCAGGCTCGCTACGAGGTCCAGAAGGCTCACGCTAAGCTCAGGGCGGCTGCTCCTAAGTCATAG
Transcript >Ani_SJS100_1|g3499.t1
ATGTACCGCCAGTCGTTCGCTCCACCCCCAGCGCAGTCCCCTCCCCTTCACCATCCTGTGCCTCAGCATGTCTCG
ACCGTCCCCATGATGCGCTCGCCGCCGCCTCCGGCATCACAACAGCCTCAGACTTCTGGCTATGGCAACCCATAC
CAGCCCGCCCCTGCGCAGGGTGGCAGCGGAACCTATGCTCCTGGCTTCGGGGGGTTCATCAATGATCCCACCGCG
CAGATGGGATTCCAGGTCGGAAAGACCGCCATGGCAGCTGGACAGGAATATATGGAGCAGAACTTCAATCGCTAT
GTCTCTATACCAGCTCTAAAGCACTATTTCAACGTCTCGAATTCTTACGTCCTGAACAAATTGTCCCTCGTTCTC
TTCCCTTGGCGGCACAAACCCTGGTCCCGTCAACAGGCGCGTCTTACAACAGCTTCAACTGGTCCCAATGGCCAG
ATATCCCAGCAGCAGTACTCTTCCATGTTCCTCCCTCCGCGCGATGATCTCAACTCTCCAGACATGTATATCCCC
GTCATGGCACTTGTCACATACATCCTTCTCTCAGCGATGTTGGCCGGATTCCGCGGTAACTTCCATCCGGAGCTG
CTTGGTTCAATTACTACTACTGCTATCGCTGTCATACTGTTCGAGATAATGTGCTTGAAGCTGGCCATGTACATC
CTCAGCATCAACAACGAGTCACAGCTGCTGGATTTGGTAGCATATTCGGGATACAAGTTTGTCGGCATCATCGTC
ACTTTGTTGACATCTGAGATCCTCACTCCGGGCCGAGGAACCGGCGGCTGGGTTGGCTGGGTCGTCTTCATTTAC
ACCTTCCTTGCTAATGCCTTCTTTCTGCTCCGTTCTCTGAAATACGTTCTGCTCCCGGACTCCACAAGTGATGCA
TCCATGCGCACTGGTTCTATGCACACGGTTGCTCGCTCGCAGCGTAACCGTCGCACCCAGTTCCTGTTCATCTAC
TCGTACGTTATCCAGTTCGTGTTCATAAACCCCGGCGAGGGCTTCACAGACACTGGGTCAATCGCAAATTACCGC
ATCATCTCCCTGGTGGAGTTAACCCTAGGCCGCACGCAAACGCCCCTGGGTGGGCTGCTACTGGCTGCTAAGCGA
GACTCTTGTGGGCGAAGGGCCGCAGCACCGAAATTCGCTATCCAGCAGACCAGAGCGACTTGTGCGTTTCGGACG
ACTTCGACAACCCGACATTTCGACAACAAATTATCAACACCGTCCTCCCGGAGTCTGTCGACCGAAGCCTTCGCC
ATGGCCGATATCGATGTTCAGGTTGCTCAATGGAAGCTGGTTGAGGTTGGCCGCGTTGTGCTGATCCGCAGCGGT
CCTTACACCGGCAAGCTCGCTGCCATTGTTGAGATTGTCGACCACAAGCGTGTCTTGGTCGACGGTCCCTCCACC
GAGGAGCAGAAGATCGTTCCCCGCCACGTCCTTCCTCTCTCCCACGCCACCCTCACTCACTTCGTCATCCCCCGT
TTGCCCCGTGCTGCCGGTACTGGCCCCGTGAAGAAGCTTTGGCAGAAGGAGGAGATCGATGGCAAGTGGGCCAAG
TCCAACTTCGCCCAGAAGACCGAGCGCGCTGAGCGCAGGAAGAACCTGTCCGACTTCGAGCGCTTCAAGGTCCTC
CGCCTCCGGAAGCAGGCTCGCTACGAGGTCCAGAAGGCTCACGCTAAGCTCAGGGCGGCTGCTCCTAAGTCATAG
Gene >Ani_SJS100_1|g3499.t1
ATGTACCGCCAGTCGTTCGCTCCACCCCCAGCGCAGTCCCCTCCCCTTCACCATCCTGTGCCTCAGCATGTCTCG
ACCGTCCCCATGATGCGCTCGCCGCCGCCTCCGGCATCACAACAGCCTCAGACTTCTGGCTATGGCAACCCATAC
CAGCCCGCCCCTGCGCAGGGTGGCAGCGGAACCTATGCTCCTGGCTTCGGGGGGTTCATCAATGATCCCACCGCG
CAGATGGGATTCCAGGTCGGAAAGACCGCCATGGCAGCTGGACAGGAATATATGGAGCAGAACGTAAGCAGCAGC
TTCAAGGATGTCTCTAAGATGAAAGATGCTAACCAGGCATGAAGTTCAATCGCTATGTCTCTATACCAGCTCTAA
AGCACTATTTCAACGTCTCGAATTCTTACGTCCTGAACAAATTGTCCCTCGTTCTCTTCCCTTGGCGGCACAAAC
CCTGGTCCCGTCAACAGGCGCGTCTTACAACAGCTTCAACTGGTCCCAATGGCCAGATATCCCAGCAGCAGTACT
CTTCCATGTTCCTCCCTCCGCGCGATGATCTCAACTCTCCAGACATGTATATCCCCGTCATGGCACTTGTCACAT
ACATCCTTCTCTCAGCGATGTTGGCCGGATTCCGCGGTAACTTCCATCCGGAGCTGCTTGGTTCAATTACTACTA
CTGCTATCGCTGTCATACTGTTCGAGATAATGTGCTTGAAGCTGGCCATGTACATCCTCAGCATCAACAACGAGT
CACAGCTGCTGGATTTGGTAGCATATTCGGGATACAAGTTTGTCGGCATCATCGTCACTTTGTTGACATCTGAGA
TCCTCACTCCGGGCCGAGGAACCGGCGGCTGGGTTGGCTGGGTCGTCTTCATTTACACCTTCCTTGCTAATGCCT
TCTTTCTGGTACGTTCATGGCCATGTGCTTTTTTGATGACTGTACTAATGGTGCCTCATAGCTCCGTTCTCTGAA
ATACGTTCTGCTCCCGGACTCCACAAGTGATGCATCCATGCGCACTGGTTCTATGCACACGGTTGCTCGCTCGCA
GCGTAACCGTCGCACCCAGTTCCTGTTCATCTACTCGTACGTTATCCAGTTCGTGTTCATGTGGGTTTTGAGTCG
GGAGGGGCCGATGTCTATGGCTTCTAGTGGTGGAGCAACTGGTTCAGCATAGGGTCATGTCGGTACCGGGTTGCA
CATAATGATATAGACGGACCTCATGAAAGGGAATAGGGATATTAGTTCATATTCATGTACGCTTTGTGGAGAGCA
GTATAATTGATTTAGATTACAATTTTCTTATATCAGGGATGTAATTGGTCACGTCGTGCTCCTGCATTATGCTAG
GACATGAAGTCATACCGGATGGACGATAGCTACTGGTGAGACACGGTCACACCAGAACGGTGCGGGGCTATGCGG
TGTTCCAGCAAGTCTACTTTTGTTTACAAGCACTACAAATTTCTAGAAACAGTCACAGATGATTGATCACAGAAC
ATATATTAAATTTCAATATATCTCCAGCTAATGCCTTTATAGCGGCGCAATCGGAAGTCCTATAATCCCACGTTA
GCATTTAGTCAAGCAGGTAATGAGTGACAAAATTGCAGGATGAGATGCTCCTCAGAGATCTTGGTGATGAAGGAA
ATTTCATTGCCAAAGGCATCAACTACTATCTAGGCGTGATAAAGTTTTTTAATCACTGGAGGGGGTGTGCAATCA
AGGAAATGCAATCGCAACGTACCGAAAGAGCGCGCTGTTGGCAAGGGGAGTCGAGTGGCATGAAAGCGCAAACCT
GCTTGATCTTCGACATGTTAGCGATGAGACTCCATGAGGAAGTATAGTGTCAAGATAACAAGGTAGAAATGAGAA
TATCAGAATATGTAAGAAATTGAATATCATGCGTCAGTGCTGTATAGAAACCCCGGCGAGGGCTTCACAGACACT
GGGTCAATCGCAAATTACCGCATCATGTGAGGGGGGTATATATTAAACAAGGTAAAAGGAAGGAGTAAAGAGCTT
ACCAGTTAACGTGTGGAGAGTCAAGCTCCCTGGTGGAGTTAAGTTAGTAAACAAGATGGCGGAGTAGTTCTGGAC
AGAACGACATTTTGTTCTGATGCAAGATGGCGAAAGGTCGACAGAGTCTGGACCTTTACAGTTCTGCAAGATAGC
AAGAGGAACAAGCAAAGCAGATCGGGTTGAAAACTTGAAGCTTAAAAGCAACTCCATCGGAGCGGATAATATCCG
ACCTCCGATGGAGCGCGCTAAGGCCGGGAGGCAGCCCTAGGCCGCACGCAAACGCCCCTGGGTGGGCTGCTACTG
GCTGCTAAGCGAGACTCTTGTGGGCGAAGGGCCGCAGCACCGAAATTCGCTATCCAGCAGACCAGAGCGACTTGT
GCGTTTCGGACGACTTCGACAACCCGACATTTCGACAACAAATTATCAACACCGTCCTCCCGGAGTCTGTCGACC
GTGAGTTGCTGTCCGCCCTTACCGTGATCCCCGCAAGACTTCAACTAAGACGTCCCTTTTTGCTATTTTTCTAGG
AAGCCTTCGCCATGGCCGATATCGATGTTCAGGTTGCTCAATGGAAGCTGGTTGAGGTTGGCCGCGTTGTGCTGA
TCCGCAGCGGTCCTTACACCGGCAAGCTCGCTGCCATTGTTGAGATTGTCGACCACAAGCGTGTACGTTTTTGCG
CATATACCGGAGTTGCTACGAGCGCGAAGGAATGGGATTTCTATTAGGAGGAAATGCGATATTGACAAAGAGTTC
CACCGATTAGGTCTTGGTCGACGGTCCCTCCACCGAGGAGCAGAAGATCGTTCCCCGCCACGTCCTTCCTCTCTC
CCACGCCACCCTCACTCACTTCGTCATCCCCCGTTTGCCCCGTGCTGCCGGTACTGGCCCCGTGAAGAAGCTTTG
GCAGAAGGAGGAGATCGATGGCAAGTGGGCCAAGTCCAACTTCGCCCAGAAGACCGAGCGCGCTGAGCGCAGGAA
GAACCTGTCCGACTTCGAGCGCTTCAAGGTCCTCCGCCTCCGGAAGCAGGTACGTTTGCGAATCGCGATGATGTG
ACATGCACGGAAGATTGGGTTATATGGAGAAATCATATGAAAGTGGTCGGGACTATTGGTCGATTACTGGAAAAG
AGCCGGGGACACTATGTGCATGGAGATTGCAGGAATAGGTGCTGACATTTTGGATTCAACAGGCTCGCTACGAGG
TCCAGAAGGCTCACGCTAAGCTCAGGGCGGCTGCTCCTAAGTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail