Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g3381.t1
Gene name
Locationscaffold_015:284963..287660
Strand-
Gene length (bp)2697
Transcript length (bp)2640
Coding sequence length (bp)2640
Protein length (aa) 880

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 2.4E-12 732 776
PF17123 zf-RING_11 RING-like zinc finger 2.3E-09 732 761
PF12678 zf-rbx1 RING-H2 zinc finger domain 1.9E-08 734 776
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.2E-08 732 775
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.5E-08 733 775
PF02225 PA PA domain 2.4E-07 216 291
PF14634 zf-RING_5 zinc-RING finger domain 3.8E-07 732 776
PF13445 zf-RING_UBOX RING-type zinc-finger 5.3E-05 733 773

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 605 627 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g3381.t1
MRPPRLILVVFCLIFLPIILTFFSALTSSPRVSTPDSLAGRATGLHALFSFNIPSSLFPPSAIISLTDDNSTFFL
ARPAAFGPLLPDKGLSGQLWIGSGFGERTTAGAEGELGCSDIPGWGEGDGPKAGGGADSTTGKSGSTPGNEPTVP
QSHRQAIPQPDIDLQHDSGTRAPSPLTNDGTDDHLHHPLPESQVPDSGAMEKHGEFYSNRQAAHADIQSLQESAE
INGKVVLLSRGGCGFLEKVKWVQRRGGIALIVGDDTRGGSLVTMYARGDTSNVTIPALFTSHTTAHLLSSLVPPQ
GEDSGADDGSGTHTKISTHGSAGKQRMDATATTSATASPTSSHKAVVHDSAMPPKQKPGLFHALLSLFGLSNHGG
PVWYPPEDSRRPPSSGNINWILLDRWDEQEPSQDDTERKTSRTKTDGVSEDLKKSGTSSSSTDGDGFVIGVQDWR
DPDLVVPKGSALPSPTSTTDAAGNRVHTGVKGSHPTPATLKGGSITPGSGEYRTVEKSSVEKESKVEDSSHKSVY
DDVKPGSSSQRNGWFARHFFWATDKPGPSPSSSAHGQITSVDQKLHDATAQNGQGVNAAEHDGLWVTLTPTSMST
SPFFDTLLVLVVSPLLTLTVVYVLLLLRSRIRRRRWRAPKSLVDRLPVRTYHTIARSTSSSETSSPRSVSPGPVS
PTSPLLGAKSRSGAQLPSRSQQESHVSNASASRISSSRKGKSGSTLWRRKYTGRQVECVVCLEEYVDGQSRVMSL
PCGHEFHAECITPWLTTRRRTCPICKGDVVRSMSQNKAAEAYESAEPMNEEEHHPDADSQHSSSSAPVPISGVSE
DETSDLERHAGSETGLLEGQASSAPPSWRNFAALSYSALSGDTIWHQAQTDGSR*
Coding >Ani_SJS100_1|g3381.t1
ATGCGACCACCACGTTTGATTCTTGTCGTCTTCTGCCTCATCTTCCTCCCCATCATCCTCACGTTCTTTTCTGCT
TTAACCTCCTCGCCTAGGGTGTCCACCCCCGATTCACTCGCTGGTCGAGCGACGGGACTACACGCTCTCTTCTCC
TTCAACATCCCCTCATCCCTGTTCCCGCCGTCCGCCATCATCAGCCTTACCGATGACAACTCTACCTTTTTCCTG
GCCCGACCTGCTGCGTTTGGCCCTCTGCTTCCGGACAAGGGACTCAGCGGCCAACTCTGGATTGGCAGTGGCTTT
GGGGAACGAACAACCGCCGGAGCGGAAGGGGAGCTAGGATGCTCCGATATCCCGGGTTGGGGAGAGGGAGATGGT
CCGAAGGCGGGCGGAGGTGCCGATAGTACAACTGGGAAGTCGGGGTCTACTCCTGGAAACGAGCCGACCGTGCCA
CAGAGCCATCGTCAAGCGATTCCCCAGCCGGATATCGACCTGCAGCATGACTCCGGTACCAGAGCGCCATCCCCG
TTGACAAATGACGGCACCGATGACCATCTCCACCACCCGCTGCCCGAGTCACAAGTACCGGACTCAGGGGCCATG
GAAAAGCACGGGGAGTTCTATTCGAACCGACAAGCGGCCCATGCTGATATCCAGTCGTTGCAAGAAAGTGCTGAG
ATCAACGGCAAGGTCGTCCTACTGAGTAGGGGCGGCTGTGGCTTCTTGGAGAAGGTCAAGTGGGTCCAGCGGCGT
GGAGGAATTGCTTTGATTGTGGGGGATGACACCCGAGGAGGAAGCCTCGTCACGATGTATGCACGGGGTGATACA
TCCAACGTGACGATCCCCGCCCTCTTCACCTCTCACACTACGGCACACCTGCTGTCATCCTTAGTCCCTCCGCAA
GGGGAGGACTCGGGCGCAGACGATGGATCAGGAACACACACTAAAATATCCACTCACGGCAGTGCCGGGAAACAA
CGCATGGACGCCACGGCTACTACCTCTGCCACTGCGTCGCCAACTTCAAGTCACAAAGCAGTAGTTCACGATAGT
GCGATGCCTCCGAAGCAGAAGCCCGGGCTCTTCCACGCTCTTCTGTCATTGTTCGGTCTCAGCAACCATGGTGGA
CCCGTCTGGTACCCACCAGAGGACAGTCGTCGCCCGCCAAGCAGCGGGAACATTAATTGGATTCTACTAGATCGC
TGGGACGAACAGGAACCATCACAGGATGATACCGAGCGAAAGACCTCCCGAACGAAAACCGATGGCGTTTCCGAA
GACCTCAAGAAATCAGGCACCTCGTCGAGCAGTACTGACGGTGATGGGTTCGTCATTGGAGTACAGGACTGGAGA
GATCCAGACCTAGTAGTTCCGAAGGGCAGCGCCCTTCCGTCACCTACCAGCACCACCGACGCCGCCGGGAACAGG
GTGCATACTGGTGTCAAGGGCTCGCACCCTACGCCTGCGACTTTAAAGGGTGGCAGCATCACTCCAGGAAGTGGC
GAGTATCGCACCGTCGAGAAGTCCAGCGTTGAAAAAGAGTCGAAGGTGGAGGACTCAAGTCACAAGTCTGTGTAT
GATGATGTGAAACCAGGATCCTCTTCCCAGCGCAATGGTTGGTTTGCCAGGCATTTCTTCTGGGCGACGGACAAG
CCAGGTCCGAGCCCAAGCTCCAGCGCCCATGGGCAAATTACTTCCGTAGACCAGAAGCTGCATGATGCGACAGCT
CAGAACGGCCAGGGCGTGAATGCCGCCGAACACGACGGCTTGTGGGTCACACTCACGCCCACGAGCATGTCGACC
AGCCCTTTCTTTGATACCCTCCTCGTCTTGGTCGTCAGCCCATTACTCACGCTGACCGTTGTTTACGTCCTGCTG
TTGCTGCGGTCTCGTATCCGGCGTAGACGGTGGCGCGCTCCAAAGTCCCTCGTTGATCGCCTCCCTGTGCGAACT
TATCATACCATTGCGAGATCGACCTCTTCCTCGGAAACGAGCTCGCCACGATCCGTTAGCCCTGGTCCAGTGTCG
CCAACCTCGCCACTGTTGGGTGCGAAAAGCCGCTCAGGAGCCCAGTTGCCGTCTCGATCCCAGCAAGAGTCGCAT
GTCTCGAATGCGAGTGCGTCCAGGATATCATCATCGAGGAAGGGCAAGTCGGGGTCCACTTTGTGGCGACGGAAG
TACACTGGTCGGCAAGTGGAATGTGTTGTGTGCCTGGAGGAATATGTGGATGGGCAGAGCAGGGTGATGAGTTTG
CCCTGCGGCCACGAGTTCCACGCGGAGTGCATCACGCCTTGGCTGACGACCCGCCGGCGAACTTGTCCTATCTGC
AAAGGAGACGTGGTTCGGTCAATGTCGCAGAACAAAGCGGCGGAGGCTTACGAGTCGGCAGAGCCGATGAACGAG
GAAGAGCACCACCCTGACGCAGATTCTCAGCATAGTTCATCCTCAGCGCCGGTGCCGATCAGCGGAGTGAGCGAA
GACGAGACCTCGGACCTTGAGCGGCATGCTGGCTCTGAAACAGGTCTTCTCGAGGGACAGGCGTCCTCGGCACCA
CCGAGTTGGAGGAACTTTGCAGCACTGAGCTACTCTGCTCTTAGTGGCGATACGATCTGGCATCAGGCTCAGACG
GACGGCAGCCGGTGA
Transcript >Ani_SJS100_1|g3381.t1
ATGCGACCACCACGTTTGATTCTTGTCGTCTTCTGCCTCATCTTCCTCCCCATCATCCTCACGTTCTTTTCTGCT
TTAACCTCCTCGCCTAGGGTGTCCACCCCCGATTCACTCGCTGGTCGAGCGACGGGACTACACGCTCTCTTCTCC
TTCAACATCCCCTCATCCCTGTTCCCGCCGTCCGCCATCATCAGCCTTACCGATGACAACTCTACCTTTTTCCTG
GCCCGACCTGCTGCGTTTGGCCCTCTGCTTCCGGACAAGGGACTCAGCGGCCAACTCTGGATTGGCAGTGGCTTT
GGGGAACGAACAACCGCCGGAGCGGAAGGGGAGCTAGGATGCTCCGATATCCCGGGTTGGGGAGAGGGAGATGGT
CCGAAGGCGGGCGGAGGTGCCGATAGTACAACTGGGAAGTCGGGGTCTACTCCTGGAAACGAGCCGACCGTGCCA
CAGAGCCATCGTCAAGCGATTCCCCAGCCGGATATCGACCTGCAGCATGACTCCGGTACCAGAGCGCCATCCCCG
TTGACAAATGACGGCACCGATGACCATCTCCACCACCCGCTGCCCGAGTCACAAGTACCGGACTCAGGGGCCATG
GAAAAGCACGGGGAGTTCTATTCGAACCGACAAGCGGCCCATGCTGATATCCAGTCGTTGCAAGAAAGTGCTGAG
ATCAACGGCAAGGTCGTCCTACTGAGTAGGGGCGGCTGTGGCTTCTTGGAGAAGGTCAAGTGGGTCCAGCGGCGT
GGAGGAATTGCTTTGATTGTGGGGGATGACACCCGAGGAGGAAGCCTCGTCACGATGTATGCACGGGGTGATACA
TCCAACGTGACGATCCCCGCCCTCTTCACCTCTCACACTACGGCACACCTGCTGTCATCCTTAGTCCCTCCGCAA
GGGGAGGACTCGGGCGCAGACGATGGATCAGGAACACACACTAAAATATCCACTCACGGCAGTGCCGGGAAACAA
CGCATGGACGCCACGGCTACTACCTCTGCCACTGCGTCGCCAACTTCAAGTCACAAAGCAGTAGTTCACGATAGT
GCGATGCCTCCGAAGCAGAAGCCCGGGCTCTTCCACGCTCTTCTGTCATTGTTCGGTCTCAGCAACCATGGTGGA
CCCGTCTGGTACCCACCAGAGGACAGTCGTCGCCCGCCAAGCAGCGGGAACATTAATTGGATTCTACTAGATCGC
TGGGACGAACAGGAACCATCACAGGATGATACCGAGCGAAAGACCTCCCGAACGAAAACCGATGGCGTTTCCGAA
GACCTCAAGAAATCAGGCACCTCGTCGAGCAGTACTGACGGTGATGGGTTCGTCATTGGAGTACAGGACTGGAGA
GATCCAGACCTAGTAGTTCCGAAGGGCAGCGCCCTTCCGTCACCTACCAGCACCACCGACGCCGCCGGGAACAGG
GTGCATACTGGTGTCAAGGGCTCGCACCCTACGCCTGCGACTTTAAAGGGTGGCAGCATCACTCCAGGAAGTGGC
GAGTATCGCACCGTCGAGAAGTCCAGCGTTGAAAAAGAGTCGAAGGTGGAGGACTCAAGTCACAAGTCTGTGTAT
GATGATGTGAAACCAGGATCCTCTTCCCAGCGCAATGGTTGGTTTGCCAGGCATTTCTTCTGGGCGACGGACAAG
CCAGGTCCGAGCCCAAGCTCCAGCGCCCATGGGCAAATTACTTCCGTAGACCAGAAGCTGCATGATGCGACAGCT
CAGAACGGCCAGGGCGTGAATGCCGCCGAACACGACGGCTTGTGGGTCACACTCACGCCCACGAGCATGTCGACC
AGCCCTTTCTTTGATACCCTCCTCGTCTTGGTCGTCAGCCCATTACTCACGCTGACCGTTGTTTACGTCCTGCTG
TTGCTGCGGTCTCGTATCCGGCGTAGACGGTGGCGCGCTCCAAAGTCCCTCGTTGATCGCCTCCCTGTGCGAACT
TATCATACCATTGCGAGATCGACCTCTTCCTCGGAAACGAGCTCGCCACGATCCGTTAGCCCTGGTCCAGTGTCG
CCAACCTCGCCACTGTTGGGTGCGAAAAGCCGCTCAGGAGCCCAGTTGCCGTCTCGATCCCAGCAAGAGTCGCAT
GTCTCGAATGCGAGTGCGTCCAGGATATCATCATCGAGGAAGGGCAAGTCGGGGTCCACTTTGTGGCGACGGAAG
TACACTGGTCGGCAAGTGGAATGTGTTGTGTGCCTGGAGGAATATGTGGATGGGCAGAGCAGGGTGATGAGTTTG
CCCTGCGGCCACGAGTTCCACGCGGAGTGCATCACGCCTTGGCTGACGACCCGCCGGCGAACTTGTCCTATCTGC
AAAGGAGACGTGGTTCGGTCAATGTCGCAGAACAAAGCGGCGGAGGCTTACGAGTCGGCAGAGCCGATGAACGAG
GAAGAGCACCACCCTGACGCAGATTCTCAGCATAGTTCATCCTCAGCGCCGGTGCCGATCAGCGGAGTGAGCGAA
GACGAGACCTCGGACCTTGAGCGGCATGCTGGCTCTGAAACAGGTCTTCTCGAGGGACAGGCGTCCTCGGCACCA
CCGAGTTGGAGGAACTTTGCAGCACTGAGCTACTCTGCTCTTAGTGGCGATACGATCTGGCATCAGGCTCAGACG
GACGGCAGCCGGTGA
Gene >Ani_SJS100_1|g3381.t1
ATGCGACCACCACGTTTGATTCTTGTCGTCTTCTGCCTCATCTTCCTCCCCATCATCCTCACGTTCTTTTCTGCT
TTAACCTCCTCGCCTAGGGTGTCCACCCCCGATTCACTCGCTGGTCGAGCGACGGGACTACACGCTCTCTTCTCC
TTCAACATCCCCTCATCCCTGTTCCCGCCGTCCGCCATCATCAGCCTTACCGATGACAACTCTACCTTTTTCCTG
GCCCGACCTGCTGCGTTTGGCCCTCTGCTTCCGGACAAGGGACTCAGCGGCCAACTCTGGATTGGCAGTGGCTTT
GGGGAACGAACAACCGCCGGAGCGGAAGGGGAGCTAGGATGCTCCGATATCCCGGGTTGGGGAGAGGGAGATGGT
CCGAAGGCGGGCGGAGGTGCCGATAGTACAACTGGGAAGTCGGGGTCTACTCCTGGAAACGAGCCGACCGTGCCA
CAGAGCCATCGTCAAGCGATTCCCCAGCCGGATATCGACCTGCAGCATGACTCCGGTACCAGAGCGCCATCCCCG
TTGACAAATGACGGCACCGATGACCATCTCCACCACCCGCTGCCCGAGTCACAAGTACCGGACTCAGGGGCCATG
GAAAAGCACGGGGAGTTCTATTCGAACCGACAAGCGGCCCATGCTGATATCCAGTCGTTGCAAGAAAGTGCTGAG
ATCAACGGCAAGGTCGTCCTACTGAGTAGGGGCGGCTGTGGCTTCTTGGAGAAGGTCAAGTGGGTCCAGCGGCGT
GGAGGAATTGCTTTGATTGTGGGGGATGACACCCGAGGAGGAAGCCTCGTCACGATGTATGCACGGGGTGATACA
TCCAACGTGACGATCCCCGCCCTCTTCACCTCTCACACTACGGCACACCTGCTGTCATCCTTAGTCCCTCCGCAA
GGGGAGGACTCGGGCGCAGACGATGGATCAGGAACACACACTAAAATATCCACTCACGGCAGTGCCGGGAAACAA
CGCATGGACGCCACGGCTACTACCTCTGCCACTGCGTCGCCAACTTCAAGTCACAAAGCAGTAGTTCACGATAGT
GCGATGCCTCCGAAGCAGAAGCCCGGGCTCTTCCACGCTCTTCTGTCATTGTTCGGTCTCAGCAACCATGGTGGA
CCCGTCTGGTACCCACCAGAGGACAGTCGTCGCCCGCCAAGCAGCGGGAACATTAATTGGATTCTACTAGATCGC
TGGGACGAACAGGAACCATCACAGGATGATACCGAGCGAAAGACCTCCCGAACGAAAACCGATGGCGTTTCCGAA
GACCTCAAGAAATCAGGCACCTCGTCGAGCAGTACTGACGGTGATGGGTTCGTCATTGGAGTACAGGACTGGAGA
GATCCAGACCTAGTAGTTCCGAAGGGCAGCGCCCTTCCGTCACCTACCAGCACCACCGACGCCGCCGGGAACAGG
GTGCATACTGGTGTCAAGGGCTCGCACCCTACGCCTGCGACTTTAAAGGGTGGCAGCATCACTCCAGGAAGTGGC
GAGTATCGCACCGTCGAGAAGTCCAGCGTTGAAAAAGAGTCGAAGGTGGAGGACTCAAGTCACAAGTCTGTGTAT
GATGATGTGAAACCAGGATCCTCTTCCCAGCGCAATGGTTGGTTTGCCAGGCATTTCTTCTGGGCGACGGACAAG
CCAGGTCCGAGCCCAAGCTCCAGCGCCCATGGGCAAATTACTTCCGTAGACCAGAAGCTGCATGATGCGACAGCT
CAGAACGGCCAGGGCGTGAATGCCGCCGAACACGACGGCTTGTGGGTCACACTCACGCCCACGAGCATGTCGACC
AGCCCTTTCTTTGATACCCTCCTCGTCTTGGTCGTCAGCCCATTACTCACGCTGACCGTTGTTTACGTCCTGCTG
TTGCTGCGGTCTCGTATCCGGCGTAGACGGTGGCGCGCTCCAAAGTCCCTCGTTGATCGCCTCCCTGTGCGAACT
TATCATACCATTGCGAGATCGACCTCTTCCTCGGAAACGAGCTCGCCACGATCCGTTAGCCCTGGTCCAGTGTCG
CCAACCTCGCCACTGTTGGGTGCGAAAAGCCGCTCAGGAGCCCAGTTGCCGTCTCGATCCCAGCAAGAGTCGCAT
GTCTCGAATGCGAGTGCGTCCAGGATATCATCATCGAGGAAGGGCAAGTCGGGGTCCACTTTGTGGCGACGGAAG
TACACTGGTCGGCAAGTGGAATGTGTTGTGTGCCTGGAGGAATATGTGGATGGGCAGAGCAGGGTGATGAGTTTG
CCCTGCGGCCACGAGTTCCACGCGGAGTGCATGTAAGTCACAATGCTGGAGTCTGTTGTCAAGCATGTCCATACT
AACGATACTCGCAGCACGCCTTGGCTGACGACCCGCCGGCGAACTTGTCCTATCTGCAAAGGAGACGTGGTTCGG
TCAATGTCGCAGAACAAAGCGGCGGAGGCTTACGAGTCGGCAGAGCCGATGAACGAGGAAGAGCACCACCCTGAC
GCAGATTCTCAGCATAGTTCATCCTCAGCGCCGGTGCCGATCAGCGGAGTGAGCGAAGACGAGACCTCGGACCTT
GAGCGGCATGCTGGCTCTGAAACAGGTCTTCTCGAGGGACAGGCGTCCTCGGCACCACCGAGTTGGAGGAACTTT
GCAGCACTGAGCTACTCTGCTCTTAGTGGCGATACGATCTGGCATCAGGCTCAGACGGACGGCAGCCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail