Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g3340.t1
Gene name
Locationscaffold_015:175233..176715
Strand-
Gene length (bp)1482
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11704 Folliculin Vesicle coat protein involved in Golgi to plasma membrane transport 1.8E-53 211 390

GO

GO Term Description Terminal node
GO:0005096 GTPase activator activity Yes
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0098772 molecular function regulator activity No
GO:0030234 enzyme regulator activity No
GO:0008047 enzyme activator activity No
GO:0030695 GTPase regulator activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g3340.t1
MTACDMAGILTLALLSLTHFCEVHGPTSIICSQVLPFPCSQCYPDKSDSSPDETPATSHDTVSSHGLQSRANTKS
TPNKLSEKNIDSSDRSPRIEDHPYFLKGQATPADTQQRPNFLGGADGDTCASCSLTLPEDVSKQLPPGAPGTARS
DGKGRNGSPVLRSREVVYSCGTSHADHDDTTHDPHAHASYPDSLHSASVTSDASCHTHILTYLSLRGPPNPADYA
LLRRSSIRTLSCELLPRGLSSGPLCFGDSTAGYTIAYIFRLPDPMARGKRRSYALVALAGKDAGRAFRACPVIWR
AFGRIATGIVNSAEKYQEEEKRRDEQNNASNRRGSKQYTPVSSFLTGRALDPDGQLRRPGQVRARNLSEIVGNQY
IFAEIHAHFVALLQQLGTMFGASPISEERFVCSTVREEDATASRKSSLVPGGKEKPQDKLSRQYEDSDLGMSTLD
ISSGPKPIPIAPRRPVIA*
Coding >Ani_SJS100_1|g3340.t1
ATGACCGCGTGCGACATGGCAGGGATCCTGACTCTTGCGCTTCTTTCTTTGACGCATTTCTGCGAGGTGCATGGT
CCTACCTCGATCATCTGCTCGCAGGTCCTACCGTTCCCTTGTTCACAATGCTATCCCGACAAATCTGATTCCTCT
CCCGACGAAACCCCTGCCACCTCTCACGACACCGTTTCATCCCACGGCCTGCAGAGCCGCGCGAATACTAAATCT
ACCCCAAATAAACTCTCGGAAAAGAACATCGACTCCTCCGACAGGTCTCCCAGGATAGAAGACCATCCCTATTTC
CTCAAAGGCCAGGCCACGCCGGCTGACACTCAACAACGACCCAACTTCCTCGGCGGCGCAGACGGCGACACGTGC
GCCAGTTGCAGCTTGACTCTCCCTGAAGATGTGAGCAAGCAGCTGCCCCCAGGTGCGCCAGGAACGGCCCGAAGT
GACGGCAAAGGGAGGAACGGCAGTCCGGTTTTGCGATCGAGAGAGGTCGTCTACTCTTGTGGGACCAGTCACGCC
GACCACGATGATACCACACACGACCCGCATGCTCATGCTTCATACCCCGACTCCCTTCATTCGGCCTCTGTTACA
TCGGACGCCTCCTGTCATACACACATCCTCACCTATCTTTCATTGCGCGGACCTCCCAATCCGGCTGATTACGCG
CTTCTGCGACGTTCCTCCATTCGAACCCTGAGTTGCGAACTTTTGCCACGCGGTCTTTCCTCGGGCCCTCTATGT
TTTGGCGATTCTACCGCTGGCTATACGATAGCTTACATCTTTCGCCTGCCCGACCCCATGGCTCGCGGGAAACGG
CGTAGCTATGCCCTTGTCGCATTGGCAGGAAAAGATGCCGGACGAGCCTTCCGTGCCTGTCCTGTGATTTGGCGC
GCATTTGGTCGGATTGCCACGGGCATTGTCAACTCAGCGGAGAAATACCAGGAAGAAGAAAAGCGTCGCGATGAA
CAAAACAACGCATCGAATAGACGCGGGAGCAAGCAGTATACACCTGTTTCCTCTTTCCTCACAGGGCGCGCCCTT
GACCCAGATGGACAGCTTCGCAGACCCGGTCAAGTGCGAGCGAGAAACCTTTCGGAAATCGTGGGAAACCAATAC
ATCTTTGCTGAAATACATGCACACTTTGTTGCGCTCCTGCAGCAGCTGGGTACGATGTTTGGAGCCTCACCTATT
TCAGAAGAACGATTCGTGTGCAGCACAGTGCGCGAAGAAGACGCCACTGCTTCACGGAAATCATCATTAGTTCCT
GGTGGCAAGGAGAAGCCGCAGGATAAGCTTTCGCGACAATACGAGGACAGCGATCTGGGAATGTCCACTTTGGAC
ATCTCCTCGGGGCCTAAGCCGATCCCCATCGCACCTCGCCGACCAGTGATCGCTTAG
Transcript >Ani_SJS100_1|g3340.t1
ATGACCGCGTGCGACATGGCAGGGATCCTGACTCTTGCGCTTCTTTCTTTGACGCATTTCTGCGAGGTGCATGGT
CCTACCTCGATCATCTGCTCGCAGGTCCTACCGTTCCCTTGTTCACAATGCTATCCCGACAAATCTGATTCCTCT
CCCGACGAAACCCCTGCCACCTCTCACGACACCGTTTCATCCCACGGCCTGCAGAGCCGCGCGAATACTAAATCT
ACCCCAAATAAACTCTCGGAAAAGAACATCGACTCCTCCGACAGGTCTCCCAGGATAGAAGACCATCCCTATTTC
CTCAAAGGCCAGGCCACGCCGGCTGACACTCAACAACGACCCAACTTCCTCGGCGGCGCAGACGGCGACACGTGC
GCCAGTTGCAGCTTGACTCTCCCTGAAGATGTGAGCAAGCAGCTGCCCCCAGGTGCGCCAGGAACGGCCCGAAGT
GACGGCAAAGGGAGGAACGGCAGTCCGGTTTTGCGATCGAGAGAGGTCGTCTACTCTTGTGGGACCAGTCACGCC
GACCACGATGATACCACACACGACCCGCATGCTCATGCTTCATACCCCGACTCCCTTCATTCGGCCTCTGTTACA
TCGGACGCCTCCTGTCATACACACATCCTCACCTATCTTTCATTGCGCGGACCTCCCAATCCGGCTGATTACGCG
CTTCTGCGACGTTCCTCCATTCGAACCCTGAGTTGCGAACTTTTGCCACGCGGTCTTTCCTCGGGCCCTCTATGT
TTTGGCGATTCTACCGCTGGCTATACGATAGCTTACATCTTTCGCCTGCCCGACCCCATGGCTCGCGGGAAACGG
CGTAGCTATGCCCTTGTCGCATTGGCAGGAAAAGATGCCGGACGAGCCTTCCGTGCCTGTCCTGTGATTTGGCGC
GCATTTGGTCGGATTGCCACGGGCATTGTCAACTCAGCGGAGAAATACCAGGAAGAAGAAAAGCGTCGCGATGAA
CAAAACAACGCATCGAATAGACGCGGGAGCAAGCAGTATACACCTGTTTCCTCTTTCCTCACAGGGCGCGCCCTT
GACCCAGATGGACAGCTTCGCAGACCCGGTCAAGTGCGAGCGAGAAACCTTTCGGAAATCGTGGGAAACCAATAC
ATCTTTGCTGAAATACATGCACACTTTGTTGCGCTCCTGCAGCAGCTGGGTACGATGTTTGGAGCCTCACCTATT
TCAGAAGAACGATTCGTGTGCAGCACAGTGCGCGAAGAAGACGCCACTGCTTCACGGAAATCATCATTAGTTCCT
GGTGGCAAGGAGAAGCCGCAGGATAAGCTTTCGCGACAATACGAGGACAGCGATCTGGGAATGTCCACTTTGGAC
ATCTCCTCGGGGCCTAAGCCGATCCCCATCGCACCTCGCCGACCAGTGATCGCTTAG
Gene >Ani_SJS100_1|g3340.t1
ATGACCGCGTGCGACATGGCAGGGATCCTGACTCTTGCGCTTGTCCTTTTCCCACCCCGTCTCTAGACAGTGGAT
CCCTGTCTGCTTGCTCCAGCTAACACTTCCTCCCTCTACTAGCTTTCTTTGACGCATTTCTGCGAGGTGCATGGT
CCTACCTCGATCATCTGCTCGCAGGTCCTACCGTTCCCTTGTTCACAATGCTATCCCGACAAATCTGATTCCTCT
CCCGACGAAACCCCTGCCACCTCTCACGACACCGTTTCATCCCACGGCCTGCAGAGCCGCGCGAATACTAAATCT
ACCCCAAATAAACTCTCGGAAAAGAACATCGACTCCTCCGACAGGTCTCCCAGGATAGAAGACCATCCCTATTTC
CTCAAAGGCCAGGCCACGCCGGCTGACACTCAACAACGACCCAACTTCCTCGGCGGCGCAGACGGCGACACGTGC
GCCAGTTGCAGCTTGACTCTCCCTGAAGATGTGAGCAAGCAGCTGCCCCCAGGTGCGCCAGGAACGGCCCGAAGT
GACGGCAAAGGGAGGAACGGCAGTCCGGTTTTGCGATCGAGAGAGGTCGTCTACTCTTGTGGGACCAGTCACGCC
GACCACGATGATACCACACACGACCCGCATGCTCATGCTTCATACCCCGACTCCCTTCATTCGGCCTCTGTTACA
TCGGACGCCTCCTGTCATACACACATCCTCACCTATCTTTCATTGCGCGGACCTCCCAATCCGGCTGATTACGCG
CTTCTGCGACGTTCCTCCATTCGAACCCTGAGTTGCGAACTTTTGCCACGCGGTCTTTCCTCGGGCCCTCTATGT
TTTGGCGATTCTACCGCTGGCTATACGATAGCTTACATCTTTCGCCTGCCCGACCCCATGGCTCGCGGGAAACGG
CGTAGCTATGCCCTTGTCGCATTGGCAGGAAAAGATGCCGGACGAGCCTTCCGTGCCTGTCCTGTGATTTGGCGC
GCATTTGGTCGGATTGCCACGGGCATTGTCAACTCAGCGGAGAAATACCAGGAAGAAGAAAAGCGTCGCGATGAA
CAAAACAACGCATCGAATAGACGCGGGAGCAAGCAGTATACACCTGTTTCCTCTTTCCTCACAGGGCGCGCCCTT
GACCCAGATGGACAGCTTCGCAGACCCGGTCAAGTGCGAGCGAGAAACCTTTCGGAAATCGTGGGAAACCAATAC
ATCTTTGCTGAAATACATGCACACTTTGTTGCGCTCCTGCAGCAGCTGGGTACGATGTTTGGAGCCTCACCTATT
TCAGAAGAACGATTCGTGTGCAGCACAGTGCGCGAAGAAGACGCCACTGCTTCACGGAAATCATCATTAGTTCCT
GGTGGCAAGGAGAAGCCGCAGGATAAGCTTTCGCGACAATACGAGGACAGCGATCTGGGAATGTCCACTTTGGAC
ATCTCCTCGGGGCCTAAGCCGATCCCCATCGCACCTCGCCGACCAGTGATCGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail