Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g3010.t1
Gene name
Locationscaffold_013:230578..231078
Strand+
Gene length (bp)500
Transcript length (bp)408
Coding sequence length (bp)408
Protein length (aa) 136

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase 3.1E-36 34 125

GO

GO Term Description Terminal node
GO:0003755 peptidyl-prolyl cis-trans isomerase activity Yes
GO:0003824 catalytic activity No
GO:0016859 cis-trans isomerase activity No
GO:0016853 isomerase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g3010.t1
MRLPTLAALLTLSLTTLASAADLGIEVTHAVECTRKTQNGDTVSMHYRGKLASDGSEFDASYNRGTPLKFKLGSG
RVIKGWDQGLQGMCIGEKRTLTIPPELGYGDRGIGPIPGGATLIFETELVGIQGVDKDEL*
Coding >Ani_SJS100_1|g3010.t1
ATGCGCCTCCCAACTCTCGCCGCCCTCCTCACCCTCTCCCTCACCACCCTCGCCTCCGCCGCCGACCTCGGAATC
GAAGTCACCCACGCGGTCGAATGCACCCGCAAGACCCAAAACGGAGATACAGTGTCCATGCACTACCGGGGCAAG
CTCGCCTCCGACGGATCCGAGTTCGATGCTAGTTATAACCGCGGCACTCCGTTGAAGTTCAAGCTTGGTTCGGGG
AGAGTTATTAAGGGATGGGATCAAGGTCTCCAGGGCATGTGCATTGGGGAGAAGCGCACGTTGACGATTCCGCCG
GAGCTGGGATACGGTGATCGCGGTATTGGACCGATTCCTGGCGGTGCGACGTTGATTTTTGAGACGGAGTTGGTG
GGTATTCAGGGGGTTGATAAGGATGAGTTGTGA
Transcript >Ani_SJS100_1|g3010.t1
ATGCGCCTCCCAACTCTCGCCGCCCTCCTCACCCTCTCCCTCACCACCCTCGCCTCCGCCGCCGACCTCGGAATC
GAAGTCACCCACGCGGTCGAATGCACCCGCAAGACCCAAAACGGAGATACAGTGTCCATGCACTACCGGGGCAAG
CTCGCCTCCGACGGATCCGAGTTCGATGCTAGTTATAACCGCGGCACTCCGTTGAAGTTCAAGCTTGGTTCGGGG
AGAGTTATTAAGGGATGGGATCAAGGTCTCCAGGGCATGTGCATTGGGGAGAAGCGCACGTTGACGATTCCGCCG
GAGCTGGGATACGGTGATCGCGGTATTGGACCGATTCCTGGCGGTGCGACGTTGATTTTTGAGACGGAGTTGGTG
GGTATTCAGGGGGTTGATAAGGATGAGTTGTGA
Gene >Ani_SJS100_1|g3010.t1
ATGCGCCTCCCAACTCTCGCCGCCCTCCTCACCCTCTCCCTCACCACCCTCGCCTCCGCCGCCGACCTCGGAATC
GAAGTCACCCACGCGGTCGAATGCACCCGCAAGACCCAAAACGGAGATACAGTGTCCATGCACTACCGGGGCAAG
CTCGCCTCCGACGGATCCGAGTTCGATGCTAGTTATAACCGCGGCACTCCGTTGAAGTTCAAGCTTGGTTCGGGG
AGAGTTATTAAGGGGTATGTGTTTACCATCTTCCCACCATTGCTAGCTTGCTTTTCGAGAGGAATTGTTTATGGA
AATGGATGCTGATTTATTTTTCTGGGTGTAGATGGGATCAAGGTCTCCAGGGCATGTGCATTGGGGAGAAGCGCA
CGTTGACGATTCCGCCGGAGCTGGGATACGGTGATCGCGGTATTGGACCGATTCCTGGCGGTGCGACGTTGATTT
TTGAGACGGAGTTGGTGGGTATTCAGGGGGTTGATAAGGATGAGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail