Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g3000.t1
Gene name
Locationscaffold_013:199569..202996
Strand+
Gene length (bp)3427
Transcript length (bp)3195
Coding sequence length (bp)3195
Protein length (aa) 1065

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.2E-78 10 440
PF00667 FAD_binding_1 FAD binding domain 7.8E-28 681 882
PF00258 Flavodoxin_1 Flavodoxin 1.5E-17 500 634
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 1.1E-08 915 1023

GO

GO Term Description Terminal node
GO:0020037 heme binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0010181 FMN binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0036094 small molecule binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0046906 tetrapyrrole binding No
GO:0097367 carbohydrate derivative binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g3000.t1
MSDAKIIPIPGPRPLPLLGNILDFDLDNLTQSLDRLSKAHGPIYALTFGSSTEIMVTSRRIAEELCDETRFCKLV
AGGLEKMKPVVGDGLFTAQSDDPKWAIAHRILMPLFGTMKIREMFNDMKDICEQMCLKWARLGESFPLDVCKNFT
TLTLDTISLCTIDYRFNSFYRDGKEDPFVEAVIAVMTDAFTQSNLPDFVNNWFRHKAMADFHDHAQNLRRRTEEI
IQERRRSPVERNDLLNAMLTAVDPKTGERLSDQSVVDNLLTFLIAGHETTSSLLSFCFYYLLENPDVLQKARDEV
DQVIGDGPMMVEHLQKLPYIESILRETLRLRDPGPGFYLKPLKDDILDGKYYVKKDQPIFIVFDSVHRDPETYGS
DANNFRPSRMSQENFEKLPPCAWKPFGNGVRSCIGRPFAWQQSLLAVAMILQNFDLIKDETYKLKYHVTMTVRPV
GFHMKVRLRRQRRATDFAQKLHAPVASQVPLINHHQSIRPNTVEGSRITILHGSNAGSCEALALRLAADAGEYGF
TRSKIEPLGSAVGKLPTDNPVIIITASYNGEPADEASDFVAWLKTAGRDELSGVSFSVFGCGHRDWASTYFAVPK
LLDAEMERAGGRRIAPLGTADSATSDLFTDLEKWSVTHLFPGLGNTEHIRRDAQGVKVSSSCQVMLSDPPRVTLR
KGFVPTSITESRCLSQPGVPEKRHLELRLPDGFTYQPGDHLYVLPRNSPQNVQRVLSRFHLEGDMLLTLTRSQSL
RLPVNTPISASDLFGAYVELRQIASPKGILALADSTPDSCTQTILRDLAGDLFKVEIQDKYVSVLDLLERFPTIN
PSIGLFLSLLTPMRPRAYSFSSSPNEKPGYGTLTYTVVGSAVHDGEASAVQGIASNYLASLRHHATLYIALHPCI
ADFRLPSDNSRPLVMVAAGTGLAPFRGFIQERRFRQLAGKKVGPALLFYGCRGRDLDDMYRDEMDGYEKEGVVSI
HRAYSRVKGADFRYIDFAIARFLDHVVSLWASGGVVRVCGGKKMSNSVFEVLGPALLERDRLDGKTDVTDVAEWK
RDLPRGRYVEEIFL*
Coding >Ani_SJS100_1|g3000.t1
ATGAGCGATGCAAAAATTATCCCAATTCCTGGCCCGAGACCTCTTCCGCTTTTAGGAAACATTCTAGACTTTGAC
CTAGACAACCTAACGCAGTCACTTGATCGGCTGAGCAAAGCACATGGCCCGATATACGCCCTTACTTTCGGATCC
TCAACAGAGATCATGGTGACAAGCAGGAGGATTGCAGAAGAGCTGTGCGATGAAACACGATTTTGCAAGTTGGTG
GCAGGCGGCCTGGAAAAGATGAAGCCGGTGGTTGGAGACGGACTCTTTACCGCCCAAAGCGACGATCCCAAATGG
GCAATAGCACATCGCATCCTTATGCCACTTTTTGGCACCATGAAGATCCGGGAGATGTTCAATGACATGAAAGAC
ATATGCGAGCAGATGTGTTTGAAATGGGCGCGTCTTGGGGAATCCTTTCCTTTGGACGTGTGCAAAAACTTCACG
ACCTTGACCTTGGATACGATCAGTCTCTGTACCATCGATTACCGCTTCAACAGTTTTTATCGGGACGGAAAGGAG
GATCCGTTCGTAGAAGCAGTCATAGCTGTCATGACCGATGCTTTTACGCAGTCCAATCTGCCCGATTTTGTCAAC
AACTGGTTCCGACATAAGGCCATGGCTGATTTCCATGACCATGCGCAGAATCTGCGTCGACGAACGGAAGAGATC
ATTCAAGAACGCCGCAGATCCCCCGTGGAAAGGAATGATCTTTTGAACGCAATGCTCACTGCAGTCGACCCCAAA
ACGGGAGAGCGGTTGAGCGACCAGTCGGTAGTGGATAATCTCTTGACATTCCTCATTGCAGGACATGAGACCACT
TCAAGTCTACTTTCATTCTGCTTCTATTATCTGCTTGAGAACCCCGATGTTCTTCAAAAGGCTCGTGACGAGGTT
GACCAAGTGATTGGGGACGGCCCCATGATGGTTGAGCACCTCCAAAAACTTCCATACATTGAATCGATCTTGCGA
GAGACTCTTCGGCTGCGAGATCCGGGGCCAGGTTTTTATCTTAAGCCTCTGAAGGATGACATCTTAGATGGAAAG
TATTATGTGAAGAAGGATCAACCCATATTCATCGTCTTTGATTCAGTGCACCGGGACCCCGAGACCTACGGCTCT
GATGCGAACAATTTCAGACCCAGTCGAATGTCACAGGAAAACTTCGAGAAGCTTCCACCCTGTGCATGGAAGCCG
TTCGGAAACGGAGTGCGTAGCTGCATTGGAAGGCCCTTTGCATGGCAGCAATCTCTTCTTGCTGTGGCGATGATT
CTGCAGAATTTTGATTTGATTAAGGATGAGACCTATAAGCTTAAGTACCATGTAACCATGACAGTTCGACCTGTC
GGCTTCCACATGAAGGTGCGTCTTCGACGTCAGAGGCGAGCGACCGACTTTGCCCAGAAACTTCACGCTCCTGTA
GCCTCGCAGGTACCACTGATCAACCACCATCAGTCAATCCGTCCGAATACTGTTGAAGGATCACGGATAACCATA
TTACACGGTTCTAATGCTGGAAGCTGTGAGGCCCTGGCACTTCGCCTGGCAGCTGATGCCGGAGAATATGGATTC
ACTAGAAGCAAGATTGAACCACTGGGATCGGCCGTCGGCAAGCTACCAACAGATAATCCGGTCATCATTATCACG
GCTTCTTACAACGGCGAGCCAGCAGATGAAGCGTCTGACTTTGTAGCTTGGTTGAAAACTGCAGGACGTGACGAA
TTAAGTGGCGTTTCATTTTCCGTTTTCGGCTGCGGTCATCGTGACTGGGCAAGCACGTACTTCGCAGTGCCTAAG
TTGCTTGATGCTGAGATGGAGCGAGCAGGGGGGAGAAGGATCGCCCCTCTAGGTACAGCAGATTCCGCAACGAGC
GATCTGTTTACAGATCTTGAAAAATGGTCCGTCACACATCTGTTCCCGGGGTTAGGAAACACCGAGCACATACGA
AGAGATGCGCAGGGTGTCAAGGTGTCGTCAAGTTGTCAAGTCATGCTCAGCGATCCACCACGGGTCACTCTACGG
AAGGGATTTGTTCCGACGAGTATCACAGAGTCCCGGTGCCTCTCACAACCTGGAGTTCCCGAAAAGCGACATCTG
GAACTTCGTCTCCCAGACGGGTTTACTTACCAACCGGGTGATCATCTTTATGTCCTTCCCCGTAACAGCCCTCAA
AATGTTCAGCGTGTCCTGTCAAGATTCCATCTTGAGGGTGATATGCTCCTCACTTTGACTAGATCCCAATCTCTG
AGACTCCCTGTCAATACCCCAATCTCAGCCTCGGACCTGTTCGGCGCCTACGTTGAGCTCCGGCAGATTGCCAGT
CCAAAAGGCATCCTTGCCTTGGCCGATTCCACCCCTGATAGTTGCACTCAAACAATACTGAGAGACTTGGCCGGT
GATCTCTTCAAAGTCGAGATACAAGATAAATATGTTTCTGTCTTGGATCTTCTGGAACGTTTCCCGACGATTAAT
CCTTCCATTGGGCTCTTTCTATCTCTTCTCACACCTATGCGGCCACGGGCCTATTCCTTCTCGTCCTCTCCAAAC
GAAAAGCCAGGATATGGAACGCTAACCTATACTGTCGTGGGATCCGCTGTACATGATGGGGAAGCTAGCGCAGTA
CAGGGAATCGCATCGAATTACTTAGCCTCTTTACGCCATCATGCGACCCTCTACATAGCACTACACCCTTGTATA
GCGGACTTTCGTCTCCCTTCTGATAATTCTAGACCCTTGGTCATGGTAGCCGCTGGGACAGGCTTAGCTCCCTTC
AGAGGATTCATCCAGGAGCGCAGGTTCCGACAATTGGCGGGCAAGAAGGTTGGTCCTGCGCTGCTCTTCTATGGA
TGCCGCGGAAGAGATCTAGATGATATGTATCGAGACGAGATGGATGGGTATGAAAAGGAAGGTGTGGTCAGTATC
CATCGGGCGTATAGTCGTGTAAAGGGTGCAGATTTCAGGTACATCGACTTTGCGATAGCGAGATTTCTCGATCAC
GTGGTATCACTATGGGCCAGTGGCGGCGTTGTTAGGGTCTGTGGAGGGAAGAAGATGTCGAACTCGGTCTTCGAA
GTGTTAGGTCCTGCGTTGCTGGAACGGGATAGGCTCGATGGCAAGACTGACGTAACGGATGTGGCAGAGTGGAAG
CGCGACCTTCCGCGCGGGAGATATGTTGAGGAGATATTTCTGTAG
Transcript >Ani_SJS100_1|g3000.t1
ATGAGCGATGCAAAAATTATCCCAATTCCTGGCCCGAGACCTCTTCCGCTTTTAGGAAACATTCTAGACTTTGAC
CTAGACAACCTAACGCAGTCACTTGATCGGCTGAGCAAAGCACATGGCCCGATATACGCCCTTACTTTCGGATCC
TCAACAGAGATCATGGTGACAAGCAGGAGGATTGCAGAAGAGCTGTGCGATGAAACACGATTTTGCAAGTTGGTG
GCAGGCGGCCTGGAAAAGATGAAGCCGGTGGTTGGAGACGGACTCTTTACCGCCCAAAGCGACGATCCCAAATGG
GCAATAGCACATCGCATCCTTATGCCACTTTTTGGCACCATGAAGATCCGGGAGATGTTCAATGACATGAAAGAC
ATATGCGAGCAGATGTGTTTGAAATGGGCGCGTCTTGGGGAATCCTTTCCTTTGGACGTGTGCAAAAACTTCACG
ACCTTGACCTTGGATACGATCAGTCTCTGTACCATCGATTACCGCTTCAACAGTTTTTATCGGGACGGAAAGGAG
GATCCGTTCGTAGAAGCAGTCATAGCTGTCATGACCGATGCTTTTACGCAGTCCAATCTGCCCGATTTTGTCAAC
AACTGGTTCCGACATAAGGCCATGGCTGATTTCCATGACCATGCGCAGAATCTGCGTCGACGAACGGAAGAGATC
ATTCAAGAACGCCGCAGATCCCCCGTGGAAAGGAATGATCTTTTGAACGCAATGCTCACTGCAGTCGACCCCAAA
ACGGGAGAGCGGTTGAGCGACCAGTCGGTAGTGGATAATCTCTTGACATTCCTCATTGCAGGACATGAGACCACT
TCAAGTCTACTTTCATTCTGCTTCTATTATCTGCTTGAGAACCCCGATGTTCTTCAAAAGGCTCGTGACGAGGTT
GACCAAGTGATTGGGGACGGCCCCATGATGGTTGAGCACCTCCAAAAACTTCCATACATTGAATCGATCTTGCGA
GAGACTCTTCGGCTGCGAGATCCGGGGCCAGGTTTTTATCTTAAGCCTCTGAAGGATGACATCTTAGATGGAAAG
TATTATGTGAAGAAGGATCAACCCATATTCATCGTCTTTGATTCAGTGCACCGGGACCCCGAGACCTACGGCTCT
GATGCGAACAATTTCAGACCCAGTCGAATGTCACAGGAAAACTTCGAGAAGCTTCCACCCTGTGCATGGAAGCCG
TTCGGAAACGGAGTGCGTAGCTGCATTGGAAGGCCCTTTGCATGGCAGCAATCTCTTCTTGCTGTGGCGATGATT
CTGCAGAATTTTGATTTGATTAAGGATGAGACCTATAAGCTTAAGTACCATGTAACCATGACAGTTCGACCTGTC
GGCTTCCACATGAAGGTGCGTCTTCGACGTCAGAGGCGAGCGACCGACTTTGCCCAGAAACTTCACGCTCCTGTA
GCCTCGCAGGTACCACTGATCAACCACCATCAGTCAATCCGTCCGAATACTGTTGAAGGATCACGGATAACCATA
TTACACGGTTCTAATGCTGGAAGCTGTGAGGCCCTGGCACTTCGCCTGGCAGCTGATGCCGGAGAATATGGATTC
ACTAGAAGCAAGATTGAACCACTGGGATCGGCCGTCGGCAAGCTACCAACAGATAATCCGGTCATCATTATCACG
GCTTCTTACAACGGCGAGCCAGCAGATGAAGCGTCTGACTTTGTAGCTTGGTTGAAAACTGCAGGACGTGACGAA
TTAAGTGGCGTTTCATTTTCCGTTTTCGGCTGCGGTCATCGTGACTGGGCAAGCACGTACTTCGCAGTGCCTAAG
TTGCTTGATGCTGAGATGGAGCGAGCAGGGGGGAGAAGGATCGCCCCTCTAGGTACAGCAGATTCCGCAACGAGC
GATCTGTTTACAGATCTTGAAAAATGGTCCGTCACACATCTGTTCCCGGGGTTAGGAAACACCGAGCACATACGA
AGAGATGCGCAGGGTGTCAAGGTGTCGTCAAGTTGTCAAGTCATGCTCAGCGATCCACCACGGGTCACTCTACGG
AAGGGATTTGTTCCGACGAGTATCACAGAGTCCCGGTGCCTCTCACAACCTGGAGTTCCCGAAAAGCGACATCTG
GAACTTCGTCTCCCAGACGGGTTTACTTACCAACCGGGTGATCATCTTTATGTCCTTCCCCGTAACAGCCCTCAA
AATGTTCAGCGTGTCCTGTCAAGATTCCATCTTGAGGGTGATATGCTCCTCACTTTGACTAGATCCCAATCTCTG
AGACTCCCTGTCAATACCCCAATCTCAGCCTCGGACCTGTTCGGCGCCTACGTTGAGCTCCGGCAGATTGCCAGT
CCAAAAGGCATCCTTGCCTTGGCCGATTCCACCCCTGATAGTTGCACTCAAACAATACTGAGAGACTTGGCCGGT
GATCTCTTCAAAGTCGAGATACAAGATAAATATGTTTCTGTCTTGGATCTTCTGGAACGTTTCCCGACGATTAAT
CCTTCCATTGGGCTCTTTCTATCTCTTCTCACACCTATGCGGCCACGGGCCTATTCCTTCTCGTCCTCTCCAAAC
GAAAAGCCAGGATATGGAACGCTAACCTATACTGTCGTGGGATCCGCTGTACATGATGGGGAAGCTAGCGCAGTA
CAGGGAATCGCATCGAATTACTTAGCCTCTTTACGCCATCATGCGACCCTCTACATAGCACTACACCCTTGTATA
GCGGACTTTCGTCTCCCTTCTGATAATTCTAGACCCTTGGTCATGGTAGCCGCTGGGACAGGCTTAGCTCCCTTC
AGAGGATTCATCCAGGAGCGCAGGTTCCGACAATTGGCGGGCAAGAAGGTTGGTCCTGCGCTGCTCTTCTATGGA
TGCCGCGGAAGAGATCTAGATGATATGTATCGAGACGAGATGGATGGGTATGAAAAGGAAGGTGTGGTCAGTATC
CATCGGGCGTATAGTCGTGTAAAGGGTGCAGATTTCAGGTACATCGACTTTGCGATAGCGAGATTTCTCGATCAC
GTGGTATCACTATGGGCCAGTGGCGGCGTTGTTAGGGTCTGTGGAGGGAAGAAGATGTCGAACTCGGTCTTCGAA
GTGTTAGGTCCTGCGTTGCTGGAACGGGATAGGCTCGATGGCAAGACTGACGTAACGGATGTGGCAGAGTGGAAG
CGCGACCTTCCGCGCGGGAGATATGTTGAGGAGATATTTCTGTAG
Gene >Ani_SJS100_1|g3000.t1
ATGAGCGATGCAAAAATTATCCCAATTCCTGGCCCGAGACGTAAGCCCTACCATCCGTTAAAGTCAGGTCTAAAT
AATACTGACAGAACAATTCAGCTCTTCCGCTTTTAGGAAACATTCTAGACTTTGACCTAGACAACCTAACGCAGT
CACTTGATCGGCTGAGCAAAGCACATGGTATAGTTTAAACGAGATGCTGCCGTCACTGGACTTTCCCGTGCTGAT
TCTATTGCACTTAGGCCCGATATACGCCCTTACTTTCGGATCCTCAACAGAGATCATGGTGACAAGCAGGAGGAT
TGCAGAAGAGCTGTGCGATGAAACACGATTTTGCAAGTTGGTGGCAGGCGGCCTGGAAAAGATGAAGCCGGTGGT
TGGAGACGGACTCTTTACCGCCCAAAGCGACGATCCCAAATGGGCAATAGCACATCGCATCCTTATGCCACTTTT
TGGCACCATGAAGATCCGGGAGATGTTCAATGACATGAAAGACATATGCGAGCAGATGTGTTTGAAATGGGCGCG
TCTTGGGGAATCCTTTCCTTTGGACGTGTGCAAAAACTTCACGACCTTGACCTTGGATACGATCAGTCTCTGTAC
CATCGATTACCGCTTCAACAGTTTTTATCGGGACGGAAAGGAGGATCCGTTCGTAGAAGCAGTCATAGCTGTCAT
GACCGATGCTTTTACGCAGTCCAATCTGCCCGATTTTGTCAACAACTGGTTCCGACATAAGGCCATGGCTGATTT
CCATGACCATGCGCAGAATCTGCGTCGACGAACGGAAGAGATCATTCAAGAACGCCGCAGATCCCCCGTGGAAAG
GAATGATCTTTTGAACGCAATGCTCACTGCAGTCGACCCCAAAACGGGAGAGCGGTTGAGCGACCAGTCGGTAGT
GGATAATCTCTTGACATTCCTCATTGCAGGACATGAGACCACTTCAAGTCTACTTTCATTCTGCTTCTATTATCT
GCTTGAGAACCCCGATGTTCTTCAAAAGGCTCGTGACGAGGTTGACCAAGTGATTGGGGACGGCCCCATGATGGT
TGAGCACCTCCAAAAACTTCCATACATTGAATCGATCTTGCGAGAGACTCTTCGGCTGCGAGATCCGGGGCCAGG
TTTTTATCTTAAGCCTCTGAAGGATGACATCTTAGATGGAAAGTATTATGTGAAGAAGGATCAACCCATATTCAT
CGTCTTTGATTCAGTGCACCGGGACCCCGAGACCTACGGCTCTGATGCGAACAATTTCAGACCCAGTCGAATGTC
ACAGGAAAACTTCGAGAAGCTTCCACCCTGTGCATGGAAGCCGTTCGGAAACGGAGTGCGTAGCTGCATTGGAAG
GCCCTTTGCATGGCAGCAATCTCTTCTTGTGAGTCTGATCAGGGCCCGCTAAAAAATGTCACGCATATTGGCTGA
CGTTACACATAGGCTGTGGCGATGATTCTGCAGAATTTTGATTTGATTAAGGATGAGACCTATAAGCTTAAGTAC
CATGTAACCATGACAGTTCGACCTGTCGGCTTCCACATGAAGGTGCGTCTTCGACGTCAGAGGCGAGCGACCGAC
TTTGCCCAGAAACTTCACGCTCCTGTAGCCTCGCAGGTACCACTGATCAACCACCATCAGTCAATCCGTCCGAAT
ACTGTTGAAGGATCACGGATAACCATATTACACGGTTCTAATGCTGGAAGCTGTGAGGCCCTGGCACTTCGCCTG
GCAGCTGATGCCGGAGAATATGGATTCACTAGAAGCAAGATTGAACCACTGGGATCGGCCGTCGGCAAGCTACCA
ACAGATAATCCGGTCATCATTATCACGGCTTCTTACAACGGCGAGCCAGCAGATGAAGCGTCTGACTTTGTAGCT
TGGTTGAAAACTGCAGGACGTGACGAATTAAGTGGCGTTTCATTTTCCGTTTTCGGCTGCGGTTAGAGTCCCTAT
TTTTGTCTTCTTCAATTGCACGAGGACTAAATTTTATACAGGTCATCGTGACTGGGCAAGCACGTACTTCGCAGT
GCCTAAGTTGCTTGATGCTGAGATGGAGCGAGCAGGGGGGAGAAGGATCGCCCCTCTAGGTACAGCAGATTCCGC
AACGAGCGATCTGTTTACAGATCTTGAAAAATGGTCCGTCACACATCTGTTCCCGGGGTTAGGAAACACCGAGCA
CATACGAAGAGATGCGCAGGGTGTCAAGGTGTCGTCAAGTTGTCAAGTCATGCTCAGCGATCCACCACGGGTCAC
TCTACGGAAGGGATTTGTTCCGACGAGTATCACAGAGTCCCGGTGCCTCTCACAACCTGGAGTTCCCGAAAAGCG
ACATCTGGAACTTCGTCTCCCAGACGGGTTTACTTACCAACCGGGTGATCATCTTTATGTCCTTCCCCGTAACAG
CCCTCAAAATGTTCAGCGTGTCCTGTCAAGATTCCATCTTGAGGGTGATATGCTCCTCACTTTGACTAGATCCCA
ATCTCTGAGACTCCCTGTCAATACCCCAATCTCAGCCTCGGACCTGTTCGGCGCCTACGTTGAGCTCCGGCAGAT
TGCCAGTCCAAAAGGCATCCTTGCCTTGGCCGATTCCACCCCTGATAGTTGCACTCAAACAATACTGAGAGACTT
GGCCGGTGATCTCTTCAAAGTCGAGATACAAGATAAATATGTTTCTGTCTTGGATCTTCTGGAACGTTTCCCGAC
GATTAATCCTTCCATTGGGCTCTTTCTATCTCTTCTCACACCTATGCGGCCACGGGCCTATTCCTTCTCGTCCTC
TCCAAACGAAAAGCCAGGATATGGAACGCTAACCTATACTGTCGTGGGATCCGCTGTACATGATGGGGAAGCTAG
CGCAGTACAGGGAATCGCATCGAATTACTTAGCCTCTTTACGCCATCATGCGACCCTCTACATAGCACTACACCC
TTGTATAGCGGACTTTCGTCTCCCTTCTGATAATTCTAGACCCTTGGTCATGGTAGCCGCTGGGACAGGCTTAGC
TCCCTTCAGAGGATTCATCCAGGAGCGCAGGTTCCGACAATTGGCGGGCAAGAAGGTTGGTCCTGCGCTGCTCTT
CTATGGATGCCGCGGAAGAGATCTAGATGATATGTATCGAGACGAGATGGATGGGTATGAAAAGGAAGGTGTGGT
CAGTATCCATCGGGCGTATAGTCGTGTAAAGGGTGCAGATTTCAGGTACATCGACTTTGCGATAGCGAGATTTCT
CGATCACGTGGTATCACTATGGGCCAGTGGCGGCGTTGTTAGGGTCTGTGGAGGGAAGAAGATGTCGAACTCGGT
CTTCGAAGTGTTAGGTCCTGCGTTGCTGGAACGGGATAGGCTCGATGGCAAGACTGACGTAACGGATGTGGCAGA
GTGGAAGCGCGACCTTCCGCGCGGGAGATATGTTGAGGAGATATTTCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail