Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g2999.t1
Gene name
Locationscaffold_013:197900..199019
Strand-
Gene length (bp)1119
Transcript length (bp)933
Coding sequence length (bp)933
Protein length (aa) 311

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.6E-27 8 211
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.8E-14 15 245
PF08659 KR KR domain 1.4E-07 10 188

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g2999.t1
MFDVQGNYALVAGGSKGLGREISLALVKRGAHVTVIARSQDALDRIKVDMEAVRVHGDQVIGIQSLDLTNSEEVS
RFVQTFGNKITALFCTAGGTDEEVGHFVDIPATSIQSCMEKNYLTAAFVAQAVMGTWTTELKRVGECDGAQKSRH
IVFTASTAALVAVPGYAAYSPSKAAIRALADSLRQESLMYPPAGAIQVHCSFPGTFYTDSFYREQARKPQLCKEI
EGTVNDGGGLTAKDVAQRVLVGLDSGCYFIPTDLQTRLLLNNMRGPSPRDYPLLDWCMGWAASLVWPIIGTYLDW
KVARSGGGTV*
Coding >Ani_SJS100_1|g2999.t1
ATGTTTGATGTGCAAGGAAATTATGCTCTGGTGGCAGGTGGCTCCAAGGGTTTGGGAAGAGAAATCTCACTGGCG
TTGGTAAAGCGAGGAGCTCACGTGACAGTGATTGCGCGCTCTCAAGATGCATTGGATAGGATCAAAGTGGACATG
GAAGCGGTACGCGTGCATGGCGATCAAGTCATCGGTATCCAGAGCTTGGATTTGACCAATAGTGAAGAAGTGTCC
AGATTTGTCCAGACATTTGGAAACAAGATCACCGCTCTGTTCTGTACCGCAGGTGGCACGGACGAAGAGGTGGGC
CACTTTGTGGACATCCCTGCGACCTCAATTCAGAGCTGCATGGAGAAGAATTATCTTACAGCAGCGTTTGTTGCT
CAGGCTGTCATGGGGACATGGACGACTGAGTTGAAGCGGGTAGGAGAGTGCGACGGTGCCCAGAAATCTCGCCAC
ATTGTTTTCACTGCTTCCACAGCAGCCCTCGTCGCTGTCCCAGGATACGCTGCATACTCACCATCAAAGGCAGCG
ATCCGAGCATTGGCCGATTCCTTGAGGCAGGAAAGTCTCATGTACCCCCCTGCTGGGGCGATACAAGTTCACTGT
AGCTTCCCTGGGACATTTTACACGGACAGCTTCTATAGAGAACAGGCGCGGAAGCCGCAATTATGCAAAGAAATT
GAAGGAACTGTTAATGATGGTGGTGGGTTGACAGCCAAAGATGTTGCTCAGCGTGTTCTTGTTGGACTTGATTCG
GGGTGTTACTTCATACCCACGGATCTGCAAACCCGGTTGCTCCTGAATAACATGCGAGGTCCCAGCCCACGGGAC
TACCCATTACTTGACTGGTGCATGGGCTGGGCTGCCTCGTTGGTCTGGCCAATTATAGGAACTTATCTAGACTGG
AAGGTAGCAAGGTCTGGCGGCGGAACTGTATAA
Transcript >Ani_SJS100_1|g2999.t1
ATGTTTGATGTGCAAGGAAATTATGCTCTGGTGGCAGGTGGCTCCAAGGGTTTGGGAAGAGAAATCTCACTGGCG
TTGGTAAAGCGAGGAGCTCACGTGACAGTGATTGCGCGCTCTCAAGATGCATTGGATAGGATCAAAGTGGACATG
GAAGCGGTACGCGTGCATGGCGATCAAGTCATCGGTATCCAGAGCTTGGATTTGACCAATAGTGAAGAAGTGTCC
AGATTTGTCCAGACATTTGGAAACAAGATCACCGCTCTGTTCTGTACCGCAGGTGGCACGGACGAAGAGGTGGGC
CACTTTGTGGACATCCCTGCGACCTCAATTCAGAGCTGCATGGAGAAGAATTATCTTACAGCAGCGTTTGTTGCT
CAGGCTGTCATGGGGACATGGACGACTGAGTTGAAGCGGGTAGGAGAGTGCGACGGTGCCCAGAAATCTCGCCAC
ATTGTTTTCACTGCTTCCACAGCAGCCCTCGTCGCTGTCCCAGGATACGCTGCATACTCACCATCAAAGGCAGCG
ATCCGAGCATTGGCCGATTCCTTGAGGCAGGAAAGTCTCATGTACCCCCCTGCTGGGGCGATACAAGTTCACTGT
AGCTTCCCTGGGACATTTTACACGGACAGCTTCTATAGAGAACAGGCGCGGAAGCCGCAATTATGCAAAGAAATT
GAAGGAACTGTTAATGATGGTGGTGGGTTGACAGCCAAAGATGTTGCTCAGCGTGTTCTTGTTGGACTTGATTCG
GGGTGTTACTTCATACCCACGGATCTGCAAACCCGGTTGCTCCTGAATAACATGCGAGGTCCCAGCCCACGGGAC
TACCCATTACTTGACTGGTGCATGGGCTGGGCTGCCTCGTTGGTCTGGCCAATTATAGGAACTTATCTAGACTGG
AAGGTAGCAAGGTCTGGCGGCGGAACTGTATAA
Gene >Ani_SJS100_1|g2999.t1
ATGTTTGATGTGCAAGGAAATGTACTAAACAGTCCTGACTGACATTTGTCTCTTTTGCATGGGTTGCTAAGTAGA
CTTAGTATGCTCTGGTGGCAGGTGGCTCCAAGGGTTTGGGAAGAGAAATCTCACTGGCGTTGGTAAAGCGAGGTA
CGTCGAAGGACTGCACCGAGAGCTCTTAAGCGTTGCCACTGACTCTTTGCTATCAGGAGCTCACGTGACAGTGAT
TGCGCGCTCTCAAGATGCATTGGATAGGATCAAAGTGGACATGGAAGCGGTACGCGTGCATGGCGATCAAGTCAT
CGGTATCCAGAGCTTGGATTTGACCAATAGTGAAGAAGTTTGTACAATTGAATTGCGAGTCTATCTCAACGAAAC
TTTCACTGATGAGATATACTGCTTGGCTAGGTGTCCAGATTTGTCCAGACATTTGGAAACAAGATCACCGCTCTG
TTCTGTACCGCAGGTGGCACGGACGAAGAGGTGGGCCACTTTGTGGACATCCCTGCGACCTCAATTCAGAGCTGC
ATGGAGAAGAATTATCTTACAGCAGCGTTTGTTGCTCAGGCTGTCATGGGGACATGGACGACTGAGTTGAAGCGG
GTAGGAGAGTGCGACGGTGCCCAGAAATCTCGCCACATTGTTTTCACTGCTTCCACAGCAGCCCTCGTCGCTGTC
CCAGGATACGCTGCATACTCACCATCAAAGGCAGCGATCCGAGCATTGGCCGATTCCTTGAGGCAGGAAAGTCTC
ATGTACCCCCCTGCTGGGGCGATACAAGTTCACTGTAGCTTCCCTGGGACATTTTACACGGACAGCTTCTATAGA
GAACAGGCGCGGAAGCCGCAATTATGCAAAGAAATTGAAGGAACTGTTAATGATGGTGGTGGGTTGACAGCCAAA
GATGTTGCTCAGCGTGTTCTTGTTGGACTTGATTCGGGGTGTTACTTCATACCCACGGATCTGCAAACCCGGTTG
CTCCTGAATAACATGCGAGGTCCCAGCCCACGGGACTACCCATTACTTGACTGGTGCATGGGCTGGGCTGCCTCG
TTGGTCTGGCCAATTATAGGAACTTATCTAGACTGGAAGGTAGCAAGGTCTGGCGGCGGAACTGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail