Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g2989.t1
Gene name
Locationscaffold_013:165254..173241
Strand+
Gene length (bp)7987
Transcript length (bp)7584
Coding sequence length (bp)7584
Protein length (aa) 2528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14765 PS-DH Polyketide synthase dehydratase 5.2E-61 952 1210
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 3.1E-59 30 279
PF08659 KR KR domain 3.4E-59 2131 2305
PF00698 Acyl_transf_1 Acyl transferase domain 1.3E-53 582 891
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 1.2E-36 288 401
PF08242 Methyltransf_12 Methyltransferase domain 2.8E-18 1415 1523
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 1.5E-17 404 558
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 3.0E-15 1975 2107
PF13489 Methyltransf_23 Methyltransferase domain 1.0E-12 1408 1577
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 4.4E-11 1934 2053
PF00106 adh_short short chain dehydrogenase 2.1E-07 2134 2288
PF13649 Methyltransf_25 Methyltransferase domain 3.9E-07 1414 1521
PF08241 Methyltransf_11 Methyltransferase domain 2.4E-06 1415 1525
PF13847 Methyltransf_31 Methyltransferase domain 2.3E-06 1412 1529
PF00550 PP-binding Phosphopantetheine attachment site 1.5E-05 2447 2501
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 1.0E-04 1815 1871

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g2989.t1
MDSQDSSPWEISSAERSSQPGTPEEVDSLEPIAIVGMGLRLPGNIHTEQQLWELITEKRSTRGEIPKSRFNVDGF
YSPTGRAGSIAMKHGHFLTETDNFRHLDTSFFSMGRKEVDDIDPQQRMLLEVVYECMQSSGQVGWRGSKIGCYVG
VWGEDWLDLHAKDTQDAGMYRIPGGHDFAISNRISYEYDLRGPSFTIKAGCSSSLIALHDAVRAIRAGDCSGALV
AGTNLIFSPTMSIAMTEQGVLSPDGSCKTFDAAANGYARGEAINAIYVKSLSDAIKDNDKIRAVIRATATNCDGK
TPGMSMPSSEGHEALIRRAYREASLDPTETVFVEAHGTGTPVGDPLEATAIARVFGGNNDPVYIGSVKPNLGHSE
GASGVSSVIKAVLALENMTIPPNINFSTPNPKIPFQEANMEVPIDPMTWPSGKPLRVSVNSFGIGGANAHAILES
AAPISLQATVAAAASSEYVAGALNDRYTNGHTNDHTTHPKDTDEPCRLVRPPSSRRFIHVFSAAHPASLKESLVE
HERYIRENPSLMTDISYTLCNRREHLANRAYCVTSSSDGPLTFSPVTKTKRTSPITMVFTGQGAQWAGMAKELMD
DYPSFDKDIIYLGAVLAKLEHAPSWDLRDELRKPEEDSNLPKAEYSQPLVAAVQVALVNLLRQWGIRPNAVVGHS
SGEIAAAYAAKAITAEEAITIAYYRGYMTKGYQRLGGMAAIGLGREQVTRYLRQGTLIACENSPHSVTLSGDLEA
LEKTCEIIRTEEPGCLVRRLKVEMAYHSHHMLDIGDSLEALLRDRIDSKAPVVPFFSSVRATRINGAGGLNASYW
RENLESPVLFYGAISHLVESEACSEHTFLEVGPHGALRGPLRQILQAANRSNDSYITAMIRGKDCTESILHMAGE
LYLNNTPVDFGHICPSGCLLTNLPSYKWQHVHEYWAESRLSKNWRFREFPHHELLGSRILEGNDLQPEWRNVLRL
EDVPWLRDHQVINDIIFPCAGYLGMAGEAIRQISSAHEFTFRDVVVHTALVLTESKAIEMITSLRPVRLTTTLDS
VWWEFSIFSYNETAWVKHCVGQIRTGATHSSSPLPCPSHPRSTENLYPILTKVGLNYGPCFRGLSHVSCLPNKNT
ASARLLPTAVSESTYAVHPTTIDHCLQLLFPASCDGIYRRVTRLCVPTKIEQLYLCGGRSDNDAVAEAVATISSA
GVLSGRVVAKSDKGVFLSLVGGKFSPLEVDTADDLDPIGAAKLHWKPDLDLADMRTLIKASDSSHIDSLELELVE
KMALLSLIEVNVQTSHLVCDIEHLEKYRSWMHRQTSRASSNSYDLVPNAKDLLSLDSDTRLALIFKLKQLLSHTD
AASAAELISRIVDNCSAIMQGKVEGIEVLQARDGLTNYYNFVESRTDSVDFFAVAGHTKPTLRVLEIGAGTGGGT
AVVLRGLTTSSTPRRERMYSKYAFTDISAGFFVPAQERFKEYEGIEYKVLDITKDPIEQGFQAESYDLIIAGNVL
HATPSINATLANVRKLLAPEGYLFLQELSPQLQMVNLIMGILPGWWLGETDGRVNEPFLTPEEWNKALKMAGFSG
VEAAIYDGPRPYHINANIISRPVRESILGPRRVTLLHSVGNVPTTNVDRLQKSLIDNGYQVDLRTLQEGAPADQD
IVSVLELESPLFESVSHEVLLAFQDLIASRGDSKILWVTRPAQKDVSSTPGFGLTLGLARTLRSEQFLSFMTLEV
DRVDDQVYPAIVRVLGKIQSHDSTASVDADSEFILRNGVVHVGRYQPASVAQDLELMASKPGAVRLAIGRPGLLQ
SLQWIPFPTTEPRHGEVVVEPRCAGLNFRDVLLAMGIVEANNLGIGLEGSGVITDVGAGVTDLQVGDRVFYLDDN
CFSTRITMSAMRCAKIPSFLSYEEAATMPCVYATVIHSLVDIGGLQSGQSVLIHSACGGIGIAAINVCQSIGGVQ
VYVTVGNQDKVRYLMETFNIPRASIFNSRDTSFREDVLAHTNGRGVDLVLNSLSGELLHASWECVAPYGKMLEIG
KRDFIGKAKLSMDIFEANRSFIGIDLARFDAARCHPLLTRTVQMLEAGHIKPIAPRTTFSAGHIEDNFRYMQKGT
HMGKIVVTIPEGGRELPIAPIIPDLTMKANASYLLVGGMGGLGRAVATWLVEKGARHLVFFSRSAGNSEQDRRFI
QELESQGCSVRAIQGSVLNEKDVARITQATEKPIKGVFQMSMVLRDKPFMEMDLQDWTTAVGPKVQGTWNLHHAM
PSDLDFFFATGSISGSFGTPGQANYAAGNTFLNAFTQYRRSLGLPTSILHIGLMDDVGYLTQNVGKAEALRAAGG
YFLREKDLLNSLQWAIVKATISSATADSDEAQLTIGLRCDKRLSDPTNRVIWRKDARMGLYHNRDTESSSSSNGS
NGSQADALKAFMASVEADPEVVLKEPASLEVVTREMAVKIYTFMLHPLDDLDVNVSLTALGVDSLVTIEIRNWMK
RSLGGIEISTLEILNAGSIASLGRLVIEALKKKFISQITVAEGDAYLEMKAP*
Coding >Ani_SJS100_1|g2989.t1
ATGGATAGTCAAGACTCGTCTCCCTGGGAGATCTCCTCTGCGGAGCGCTCGAGTCAGCCGGGAACCCCCGAGGAA
GTTGATTCTTTGGAGCCCATAGCGATTGTTGGCATGGGTCTGAGGCTGCCGGGGAATATCCATACAGAACAGCAG
CTCTGGGAACTCATTACGGAGAAGCGATCCACGCGGGGCGAGATCCCCAAGAGTCGGTTCAACGTGGACGGGTTC
TACAGTCCCACCGGCCGGGCTGGATCGATAGCAATGAAACATGGCCATTTTCTGACAGAGACAGATAATTTCAGA
CATCTGGATACATCTTTCTTCTCGATGGGCCGGAAGGAGGTAGATGACATCGATCCACAGCAACGTATGTTACTT
GAAGTCGTATACGAATGCATGCAATCTTCAGGTCAAGTGGGCTGGCGCGGCAGCAAGATCGGCTGCTACGTTGGA
GTCTGGGGTGAAGATTGGTTGGACCTCCATGCGAAAGATACTCAGGATGCAGGCATGTATCGGATCCCTGGTGGA
CATGACTTTGCCATCTCGAACCGCATTAGCTACGAATACGACTTGAGAGGCCCCTCCTTCACCATAAAGGCCGGG
TGCTCATCGTCTTTGATCGCCTTGCATGACGCTGTTCGAGCCATTCGTGCAGGTGACTGTTCAGGAGCACTTGTT
GCAGGCACAAATCTCATTTTCTCACCTACAATGTCCATCGCTATGACAGAGCAAGGGGTGCTATCTCCGGATGGC
TCTTGCAAGACATTTGATGCGGCAGCAAACGGGTACGCCAGGGGCGAAGCCATTAACGCTATCTATGTTAAGTCC
CTTTCAGATGCAATAAAAGACAACGACAAAATCCGCGCCGTGATCAGAGCTACTGCGACTAATTGTGATGGAAAG
ACGCCGGGTATGTCAATGCCCAGCTCTGAAGGCCATGAAGCATTGATCCGTCGAGCATATCGAGAGGCGTCGCTT
GACCCCACGGAGACCGTGTTTGTCGAAGCACACGGCACAGGCACGCCCGTCGGTGACCCCCTCGAGGCTACGGCA
ATTGCACGGGTTTTTGGAGGGAATAATGACCCCGTATATATTGGAAGTGTCAAGCCGAACCTGGGTCATAGCGAG
GGCGCTTCCGGAGTCTCCTCCGTCATTAAGGCCGTGTTGGCATTGGAGAACATGACCATCCCTCCAAATATAAAC
TTCTCGACTCCGAACCCAAAGATCCCATTCCAGGAGGCAAACATGGAGGTTCCAATTGACCCAATGACGTGGCCA
TCCGGTAAACCGCTGAGAGTGAGTGTGAATTCATTCGGTATTGGGGGCGCAAATGCACACGCCATCCTCGAGAGT
GCTGCTCCGATTTCTTTGCAAGCGACTGTAGCTGCCGCCGCTAGTAGCGAGTATGTGGCCGGAGCCTTGAATGAT
CGTTATACAAACGGTCATACAAACGATCACACAACTCATCCCAAGGACACGGACGAGCCCTGCAGACTGGTGCGT
CCTCCTAGTTCTAGAAGATTCATCCATGTATTCTCAGCAGCACACCCGGCATCCCTAAAAGAAAGCTTAGTCGAG
CATGAACGATACATCAGAGAAAATCCTTCTTTGATGACTGATATATCCTACACTTTGTGCAATCGACGAGAGCAC
TTGGCGAACCGGGCTTATTGTGTTACCAGTTCCTCAGATGGACCCCTCACGTTCTCGCCTGTTACGAAGACGAAG
AGAACATCACCAATAACGATGGTATTCACTGGACAAGGGGCACAATGGGCAGGAATGGCCAAGGAGCTGATGGAT
GACTACCCTTCCTTTGACAAGGACATAATTTACCTAGGCGCCGTGCTAGCGAAGCTAGAGCACGCCCCATCGTGG
GATCTCAGAGATGAACTGCGCAAACCAGAAGAAGATAGCAACCTACCCAAAGCGGAGTATTCTCAACCCTTAGTG
GCGGCTGTTCAGGTGGCTTTGGTGAACCTCCTCCGTCAATGGGGCATCCGGCCTAACGCGGTTGTGGGTCACTCA
AGCGGAGAGATTGCAGCGGCATATGCTGCAAAAGCAATCACGGCCGAGGAAGCAATCACAATTGCTTACTACCGC
GGGTACATGACGAAAGGATATCAACGTCTTGGTGGAATGGCTGCTATAGGCCTAGGCCGTGAGCAAGTGACACGA
TATTTGAGACAGGGGACATTGATAGCCTGTGAGAACAGTCCGCATAGTGTAACATTGTCAGGGGATCTCGAAGCT
CTCGAGAAGACCTGTGAAATCATTCGGACGGAGGAACCGGGGTGCTTGGTTCGAAGGCTAAAGGTCGAGATGGCC
TACCATTCTCACCATATGCTTGACATTGGCGACTCCCTCGAGGCCCTGCTACGCGATCGCATTGACAGCAAAGCT
CCCGTAGTGCCCTTCTTCTCGAGCGTCCGCGCAACGAGAATAAATGGCGCGGGGGGGTTGAACGCAAGCTATTGG
CGAGAAAATCTCGAAAGCCCCGTACTCTTTTACGGTGCCATAAGTCATTTGGTAGAGAGTGAAGCATGTTCTGAG
CACACCTTTCTCGAAGTCGGCCCACATGGTGCCTTAAGAGGACCGCTCCGTCAAATATTGCAGGCTGCTAATCGG
TCCAACGACAGCTACATCACAGCCATGATCCGTGGCAAGGACTGCACCGAATCCATCCTGCATATGGCTGGGGAG
CTTTACTTGAACAATACACCAGTGGATTTCGGACATATTTGCCCGAGTGGGTGCCTGCTGACCAATCTTCCATCA
TACAAATGGCAGCACGTTCATGAGTACTGGGCCGAAAGCAGATTGAGCAAAAACTGGAGGTTCCGCGAGTTCCCT
CATCATGAACTATTGGGATCTAGAATACTGGAGGGGAATGATCTGCAGCCCGAATGGCGAAACGTCCTTCGCCTA
GAAGATGTACCATGGCTTCGGGATCATCAAGTCATCAACGATATCATATTCCCCTGCGCAGGGTACCTTGGAATG
GCAGGCGAGGCCATCCGACAGATATCATCTGCCCATGAATTTACCTTCCGGGATGTCGTGGTGCACACAGCATTG
GTATTGACCGAGTCAAAGGCGATTGAGATGATCACTAGTCTTCGTCCGGTCAGGTTGACAACTACCCTGGACTCT
GTCTGGTGGGAGTTTAGTATATTCTCATACAATGAGACTGCCTGGGTTAAACATTGCGTGGGACAGATCAGGACG
GGGGCTACACATTCTTCGTCTCCCTTGCCGTGTCCCAGCCATCCCCGTTCAACCGAGAATTTATATCCCATACTG
ACGAAAGTTGGTCTCAACTATGGGCCATGCTTCCGCGGATTATCCCACGTCTCTTGTCTGCCGAACAAGAACACA
GCCTCTGCCAGGTTGCTGCCAACCGCGGTTTCCGAGTCCACCTACGCTGTTCACCCTACGACCATTGATCACTGC
CTGCAGCTGTTGTTCCCAGCTAGCTGTGATGGGATTTACCGGCGTGTAACCCGTTTGTGTGTTCCGACAAAAATC
GAACAGCTCTACCTCTGCGGCGGCAGGAGTGACAATGATGCAGTCGCGGAGGCCGTTGCCACCATCAGTTCTGCT
GGCGTTCTTTCCGGAAGAGTAGTAGCCAAGTCCGATAAGGGAGTTTTCTTGTCCCTAGTCGGAGGGAAGTTTTCT
CCCCTCGAGGTGGATACAGCCGATGATCTTGACCCTATTGGCGCAGCAAAGTTACACTGGAAACCAGATCTCGAC
CTAGCCGACATGAGGACTTTGATAAAGGCCAGCGATAGCTCGCATATTGATTCTCTTGAGCTCGAGCTCGTCGAG
AAGATGGCCCTACTCAGTCTCATTGAAGTGAACGTTCAGACATCTCATCTAGTCTGTGATATTGAGCATCTTGAA
AAATATCGCTCGTGGATGCATCGGCAAACAAGTCGAGCCTCGAGCAATAGCTACGACTTGGTTCCGAATGCTAAG
GATTTGCTATCCCTGGATTCTGATACTAGGCTTGCGTTGATATTCAAGCTGAAACAGTTGTTATCGCACACTGAT
GCCGCAAGCGCAGCTGAGCTTATATCCAGGATAGTGGATAACTGCTCTGCTATTATGCAGGGAAAGGTGGAGGGA
ATCGAAGTACTGCAAGCTCGCGATGGACTGACCAACTACTACAATTTTGTCGAGTCACGAACTGACTCTGTTGAT
TTCTTCGCTGTTGCAGGTCATACCAAGCCCACGTTGAGAGTGTTGGAAATCGGGGCTGGCACTGGAGGGGGCACA
GCAGTTGTCCTGCGGGGCCTAACCACCTCGTCCACCCCAAGACGTGAGCGTATGTACTCGAAGTACGCTTTTACT
GATATCTCTGCTGGGTTCTTTGTCCCAGCGCAGGAGAGGTTTAAGGAATACGAAGGGATCGAGTATAAGGTACTC
GACATTACAAAGGACCCGATCGAGCAAGGGTTCCAGGCAGAATCGTACGATTTGATCATCGCAGGCAACGTCTTG
CATGCAACTCCCAGTATTAATGCAACTCTGGCGAACGTGCGTAAGCTGCTGGCACCTGAGGGCTATCTGTTTCTC
CAGGAATTATCGCCCCAGCTGCAAATGGTGAACCTGATTATGGGGATTCTTCCGGGATGGTGGCTGGGCGAAACT
GACGGTAGAGTCAATGAGCCGTTTTTGACACCAGAAGAATGGAACAAGGCATTGAAAATGGCCGGTTTCTCTGGG
GTTGAGGCGGCGATCTATGATGGCCCTCGCCCATACCACATCAACGCCAATATTATCTCCCGACCTGTACGGGAG
TCCATTCTGGGACCTCGTCGTGTTACTCTTCTTCACAGTGTTGGCAACGTACCTACAACTAACGTTGACCGCCTC
CAGAAGTCTCTTATCGATAATGGTTATCAGGTCGACTTGAGAACCCTTCAAGAGGGAGCACCAGCCGATCAAGAC
ATTGTCTCAGTGCTGGAGCTCGAAAGTCCCCTCTTTGAAAGCGTATCTCATGAAGTCCTATTGGCCTTTCAGGAT
CTTATTGCCAGTCGAGGAGATAGCAAAATACTATGGGTCACTAGGCCGGCCCAAAAGGATGTGAGTTCTACTCCG
GGGTTCGGTCTGACCCTAGGGCTCGCTCGAACATTGCGATCGGAACAGTTCCTCTCTTTTATGACCCTGGAAGTC
GACCGCGTCGATGACCAGGTTTATCCGGCTATCGTGCGTGTATTGGGCAAAATCCAATCGCATGACTCGACGGCA
TCAGTGGATGCAGATTCCGAGTTCATCCTCCGTAACGGAGTGGTCCATGTTGGCCGATATCAGCCAGCCTCGGTG
GCACAGGACCTGGAACTTATGGCGTCAAAGCCTGGCGCTGTCAGACTGGCGATTGGTCGTCCAGGTCTGCTACAG
TCACTGCAGTGGATTCCTTTCCCCACAACCGAACCTCGCCATGGGGAAGTTGTCGTTGAGCCTCGTTGTGCAGGC
CTAAATTTTAGAGATGTGCTTCTCGCTATGGGGATTGTGGAAGCTAACAACCTTGGCATTGGACTCGAGGGATCG
GGCGTGATCACAGACGTAGGTGCCGGAGTGACTGATCTCCAGGTGGGCGATCGAGTCTTTTACCTCGATGATAAC
TGCTTCTCTACTCGGATCACCATGTCGGCTATGAGATGTGCGAAGATCCCATCGTTCCTCTCATACGAAGAAGCG
GCCACGATGCCATGTGTTTACGCTACTGTCATTCATTCGCTTGTGGACATCGGTGGCTTGCAGAGCGGCCAGTCG
GTTTTGATACACTCAGCATGTGGAGGTATTGGAATTGCAGCCATCAATGTCTGCCAAAGTATTGGTGGGGTTCAG
GTATATGTAACAGTCGGAAATCAGGATAAAGTTCGATATCTCATGGAGACCTTCAACATTCCGCGTGCCAGCATC
TTTAATTCCCGTGACACCTCCTTCCGAGAGGACGTGCTTGCCCACACTAATGGACGCGGCGTCGATCTCGTGCTC
AACAGCTTGTCGGGTGAGCTTCTTCATGCATCCTGGGAATGTGTAGCTCCGTACGGCAAGATGCTCGAGATCGGC
AAAAGAGACTTTATTGGAAAAGCTAAGTTGAGCATGGACATCTTTGAAGCGAACAGAAGCTTTATCGGTATCGAT
CTCGCCAGATTCGACGCTGCGAGATGTCACCCTCTACTCACTCGTACGGTGCAAATGCTCGAGGCCGGACATATC
AAACCCATCGCACCTAGGACAACCTTCTCTGCTGGTCATATTGAAGACAATTTCCGTTACATGCAGAAAGGGACA
CACATGGGAAAGATCGTCGTGACTATTCCTGAAGGAGGCCGGGAACTGCCAATCGCTCCAATTATCCCAGATTTA
ACCATGAAGGCCAACGCATCATACCTACTCGTGGGAGGAATGGGCGGTCTGGGCCGAGCAGTAGCAACGTGGTTA
GTCGAGAAAGGAGCTAGGCACCTTGTCTTCTTCTCCCGATCAGCCGGAAACTCGGAACAGGACCGACGGTTCATC
CAGGAACTAGAATCGCAAGGATGCAGTGTGAGAGCTATTCAAGGGAGCGTCTTGAATGAGAAGGACGTGGCTCGC
ATCACCCAAGCCACAGAAAAACCAATCAAGGGGGTCTTCCAAATGTCAATGGTACTTCGAGACAAGCCATTCATG
GAAATGGACCTCCAAGACTGGACCACCGCAGTCGGGCCCAAAGTGCAAGGAACGTGGAACCTACACCACGCGATG
CCAAGCGACCTAGACTTCTTCTTCGCAACCGGATCCATCAGCGGGTCCTTTGGAACTCCCGGTCAAGCCAACTAC
GCTGCAGGCAACACATTCCTCAACGCCTTCACACAATACCGGAGAAGTCTGGGTCTGCCCACCTCAATCTTGCAC
ATCGGCCTCATGGACGACGTTGGGTATCTGACTCAGAATGTGGGAAAGGCCGAGGCCCTTCGCGCTGCAGGCGGG
TACTTTCTTCGGGAAAAGGACCTCTTGAATTCTCTTCAGTGGGCTATTGTAAAGGCCACCATAAGCAGTGCGACG
GCAGACAGCGACGAGGCCCAATTGACCATCGGGCTCCGGTGCGACAAGCGACTCTCTGACCCAACAAACCGAGTC
ATATGGAGAAAGGATGCTCGCATGGGACTATACCACAACCGAGACACCGAGTCATCCAGCAGCAGCAATGGTAGT
AACGGTAGTCAAGCGGATGCGCTCAAGGCATTTATGGCATCCGTGGAAGCAGATCCGGAGGTTGTGCTCAAGGAG
CCTGCGTCACTGGAAGTGGTGACGCGGGAAATGGCTGTCAAAATATACACCTTCATGCTACATCCATTGGATGAC
CTGGACGTGAACGTATCGCTAACCGCTTTGGGTGTCGATTCCCTGGTTACAATTGAGATCCGGAACTGGATGAAG
AGAAGTTTAGGCGGCATTGAGATCAGCACATTGGAAATCTTGAATGCGGGGTCCATTGCTAGTTTAGGAAGATTG
GTGATCGAGGCGTTGAAGAAGAAATTTATCTCTCAGATTACGGTGGCAGAAGGGGATGCTTATCTGGAAATGAAG
GCCCCGTGA
Transcript >Ani_SJS100_1|g2989.t1
ATGGATAGTCAAGACTCGTCTCCCTGGGAGATCTCCTCTGCGGAGCGCTCGAGTCAGCCGGGAACCCCCGAGGAA
GTTGATTCTTTGGAGCCCATAGCGATTGTTGGCATGGGTCTGAGGCTGCCGGGGAATATCCATACAGAACAGCAG
CTCTGGGAACTCATTACGGAGAAGCGATCCACGCGGGGCGAGATCCCCAAGAGTCGGTTCAACGTGGACGGGTTC
TACAGTCCCACCGGCCGGGCTGGATCGATAGCAATGAAACATGGCCATTTTCTGACAGAGACAGATAATTTCAGA
CATCTGGATACATCTTTCTTCTCGATGGGCCGGAAGGAGGTAGATGACATCGATCCACAGCAACGTATGTTACTT
GAAGTCGTATACGAATGCATGCAATCTTCAGGTCAAGTGGGCTGGCGCGGCAGCAAGATCGGCTGCTACGTTGGA
GTCTGGGGTGAAGATTGGTTGGACCTCCATGCGAAAGATACTCAGGATGCAGGCATGTATCGGATCCCTGGTGGA
CATGACTTTGCCATCTCGAACCGCATTAGCTACGAATACGACTTGAGAGGCCCCTCCTTCACCATAAAGGCCGGG
TGCTCATCGTCTTTGATCGCCTTGCATGACGCTGTTCGAGCCATTCGTGCAGGTGACTGTTCAGGAGCACTTGTT
GCAGGCACAAATCTCATTTTCTCACCTACAATGTCCATCGCTATGACAGAGCAAGGGGTGCTATCTCCGGATGGC
TCTTGCAAGACATTTGATGCGGCAGCAAACGGGTACGCCAGGGGCGAAGCCATTAACGCTATCTATGTTAAGTCC
CTTTCAGATGCAATAAAAGACAACGACAAAATCCGCGCCGTGATCAGAGCTACTGCGACTAATTGTGATGGAAAG
ACGCCGGGTATGTCAATGCCCAGCTCTGAAGGCCATGAAGCATTGATCCGTCGAGCATATCGAGAGGCGTCGCTT
GACCCCACGGAGACCGTGTTTGTCGAAGCACACGGCACAGGCACGCCCGTCGGTGACCCCCTCGAGGCTACGGCA
ATTGCACGGGTTTTTGGAGGGAATAATGACCCCGTATATATTGGAAGTGTCAAGCCGAACCTGGGTCATAGCGAG
GGCGCTTCCGGAGTCTCCTCCGTCATTAAGGCCGTGTTGGCATTGGAGAACATGACCATCCCTCCAAATATAAAC
TTCTCGACTCCGAACCCAAAGATCCCATTCCAGGAGGCAAACATGGAGGTTCCAATTGACCCAATGACGTGGCCA
TCCGGTAAACCGCTGAGAGTGAGTGTGAATTCATTCGGTATTGGGGGCGCAAATGCACACGCCATCCTCGAGAGT
GCTGCTCCGATTTCTTTGCAAGCGACTGTAGCTGCCGCCGCTAGTAGCGAGTATGTGGCCGGAGCCTTGAATGAT
CGTTATACAAACGGTCATACAAACGATCACACAACTCATCCCAAGGACACGGACGAGCCCTGCAGACTGGTGCGT
CCTCCTAGTTCTAGAAGATTCATCCATGTATTCTCAGCAGCACACCCGGCATCCCTAAAAGAAAGCTTAGTCGAG
CATGAACGATACATCAGAGAAAATCCTTCTTTGATGACTGATATATCCTACACTTTGTGCAATCGACGAGAGCAC
TTGGCGAACCGGGCTTATTGTGTTACCAGTTCCTCAGATGGACCCCTCACGTTCTCGCCTGTTACGAAGACGAAG
AGAACATCACCAATAACGATGGTATTCACTGGACAAGGGGCACAATGGGCAGGAATGGCCAAGGAGCTGATGGAT
GACTACCCTTCCTTTGACAAGGACATAATTTACCTAGGCGCCGTGCTAGCGAAGCTAGAGCACGCCCCATCGTGG
GATCTCAGAGATGAACTGCGCAAACCAGAAGAAGATAGCAACCTACCCAAAGCGGAGTATTCTCAACCCTTAGTG
GCGGCTGTTCAGGTGGCTTTGGTGAACCTCCTCCGTCAATGGGGCATCCGGCCTAACGCGGTTGTGGGTCACTCA
AGCGGAGAGATTGCAGCGGCATATGCTGCAAAAGCAATCACGGCCGAGGAAGCAATCACAATTGCTTACTACCGC
GGGTACATGACGAAAGGATATCAACGTCTTGGTGGAATGGCTGCTATAGGCCTAGGCCGTGAGCAAGTGACACGA
TATTTGAGACAGGGGACATTGATAGCCTGTGAGAACAGTCCGCATAGTGTAACATTGTCAGGGGATCTCGAAGCT
CTCGAGAAGACCTGTGAAATCATTCGGACGGAGGAACCGGGGTGCTTGGTTCGAAGGCTAAAGGTCGAGATGGCC
TACCATTCTCACCATATGCTTGACATTGGCGACTCCCTCGAGGCCCTGCTACGCGATCGCATTGACAGCAAAGCT
CCCGTAGTGCCCTTCTTCTCGAGCGTCCGCGCAACGAGAATAAATGGCGCGGGGGGGTTGAACGCAAGCTATTGG
CGAGAAAATCTCGAAAGCCCCGTACTCTTTTACGGTGCCATAAGTCATTTGGTAGAGAGTGAAGCATGTTCTGAG
CACACCTTTCTCGAAGTCGGCCCACATGGTGCCTTAAGAGGACCGCTCCGTCAAATATTGCAGGCTGCTAATCGG
TCCAACGACAGCTACATCACAGCCATGATCCGTGGCAAGGACTGCACCGAATCCATCCTGCATATGGCTGGGGAG
CTTTACTTGAACAATACACCAGTGGATTTCGGACATATTTGCCCGAGTGGGTGCCTGCTGACCAATCTTCCATCA
TACAAATGGCAGCACGTTCATGAGTACTGGGCCGAAAGCAGATTGAGCAAAAACTGGAGGTTCCGCGAGTTCCCT
CATCATGAACTATTGGGATCTAGAATACTGGAGGGGAATGATCTGCAGCCCGAATGGCGAAACGTCCTTCGCCTA
GAAGATGTACCATGGCTTCGGGATCATCAAGTCATCAACGATATCATATTCCCCTGCGCAGGGTACCTTGGAATG
GCAGGCGAGGCCATCCGACAGATATCATCTGCCCATGAATTTACCTTCCGGGATGTCGTGGTGCACACAGCATTG
GTATTGACCGAGTCAAAGGCGATTGAGATGATCACTAGTCTTCGTCCGGTCAGGTTGACAACTACCCTGGACTCT
GTCTGGTGGGAGTTTAGTATATTCTCATACAATGAGACTGCCTGGGTTAAACATTGCGTGGGACAGATCAGGACG
GGGGCTACACATTCTTCGTCTCCCTTGCCGTGTCCCAGCCATCCCCGTTCAACCGAGAATTTATATCCCATACTG
ACGAAAGTTGGTCTCAACTATGGGCCATGCTTCCGCGGATTATCCCACGTCTCTTGTCTGCCGAACAAGAACACA
GCCTCTGCCAGGTTGCTGCCAACCGCGGTTTCCGAGTCCACCTACGCTGTTCACCCTACGACCATTGATCACTGC
CTGCAGCTGTTGTTCCCAGCTAGCTGTGATGGGATTTACCGGCGTGTAACCCGTTTGTGTGTTCCGACAAAAATC
GAACAGCTCTACCTCTGCGGCGGCAGGAGTGACAATGATGCAGTCGCGGAGGCCGTTGCCACCATCAGTTCTGCT
GGCGTTCTTTCCGGAAGAGTAGTAGCCAAGTCCGATAAGGGAGTTTTCTTGTCCCTAGTCGGAGGGAAGTTTTCT
CCCCTCGAGGTGGATACAGCCGATGATCTTGACCCTATTGGCGCAGCAAAGTTACACTGGAAACCAGATCTCGAC
CTAGCCGACATGAGGACTTTGATAAAGGCCAGCGATAGCTCGCATATTGATTCTCTTGAGCTCGAGCTCGTCGAG
AAGATGGCCCTACTCAGTCTCATTGAAGTGAACGTTCAGACATCTCATCTAGTCTGTGATATTGAGCATCTTGAA
AAATATCGCTCGTGGATGCATCGGCAAACAAGTCGAGCCTCGAGCAATAGCTACGACTTGGTTCCGAATGCTAAG
GATTTGCTATCCCTGGATTCTGATACTAGGCTTGCGTTGATATTCAAGCTGAAACAGTTGTTATCGCACACTGAT
GCCGCAAGCGCAGCTGAGCTTATATCCAGGATAGTGGATAACTGCTCTGCTATTATGCAGGGAAAGGTGGAGGGA
ATCGAAGTACTGCAAGCTCGCGATGGACTGACCAACTACTACAATTTTGTCGAGTCACGAACTGACTCTGTTGAT
TTCTTCGCTGTTGCAGGTCATACCAAGCCCACGTTGAGAGTGTTGGAAATCGGGGCTGGCACTGGAGGGGGCACA
GCAGTTGTCCTGCGGGGCCTAACCACCTCGTCCACCCCAAGACGTGAGCGTATGTACTCGAAGTACGCTTTTACT
GATATCTCTGCTGGGTTCTTTGTCCCAGCGCAGGAGAGGTTTAAGGAATACGAAGGGATCGAGTATAAGGTACTC
GACATTACAAAGGACCCGATCGAGCAAGGGTTCCAGGCAGAATCGTACGATTTGATCATCGCAGGCAACGTCTTG
CATGCAACTCCCAGTATTAATGCAACTCTGGCGAACGTGCGTAAGCTGCTGGCACCTGAGGGCTATCTGTTTCTC
CAGGAATTATCGCCCCAGCTGCAAATGGTGAACCTGATTATGGGGATTCTTCCGGGATGGTGGCTGGGCGAAACT
GACGGTAGAGTCAATGAGCCGTTTTTGACACCAGAAGAATGGAACAAGGCATTGAAAATGGCCGGTTTCTCTGGG
GTTGAGGCGGCGATCTATGATGGCCCTCGCCCATACCACATCAACGCCAATATTATCTCCCGACCTGTACGGGAG
TCCATTCTGGGACCTCGTCGTGTTACTCTTCTTCACAGTGTTGGCAACGTACCTACAACTAACGTTGACCGCCTC
CAGAAGTCTCTTATCGATAATGGTTATCAGGTCGACTTGAGAACCCTTCAAGAGGGAGCACCAGCCGATCAAGAC
ATTGTCTCAGTGCTGGAGCTCGAAAGTCCCCTCTTTGAAAGCGTATCTCATGAAGTCCTATTGGCCTTTCAGGAT
CTTATTGCCAGTCGAGGAGATAGCAAAATACTATGGGTCACTAGGCCGGCCCAAAAGGATGTGAGTTCTACTCCG
GGGTTCGGTCTGACCCTAGGGCTCGCTCGAACATTGCGATCGGAACAGTTCCTCTCTTTTATGACCCTGGAAGTC
GACCGCGTCGATGACCAGGTTTATCCGGCTATCGTGCGTGTATTGGGCAAAATCCAATCGCATGACTCGACGGCA
TCAGTGGATGCAGATTCCGAGTTCATCCTCCGTAACGGAGTGGTCCATGTTGGCCGATATCAGCCAGCCTCGGTG
GCACAGGACCTGGAACTTATGGCGTCAAAGCCTGGCGCTGTCAGACTGGCGATTGGTCGTCCAGGTCTGCTACAG
TCACTGCAGTGGATTCCTTTCCCCACAACCGAACCTCGCCATGGGGAAGTTGTCGTTGAGCCTCGTTGTGCAGGC
CTAAATTTTAGAGATGTGCTTCTCGCTATGGGGATTGTGGAAGCTAACAACCTTGGCATTGGACTCGAGGGATCG
GGCGTGATCACAGACGTAGGTGCCGGAGTGACTGATCTCCAGGTGGGCGATCGAGTCTTTTACCTCGATGATAAC
TGCTTCTCTACTCGGATCACCATGTCGGCTATGAGATGTGCGAAGATCCCATCGTTCCTCTCATACGAAGAAGCG
GCCACGATGCCATGTGTTTACGCTACTGTCATTCATTCGCTTGTGGACATCGGTGGCTTGCAGAGCGGCCAGTCG
GTTTTGATACACTCAGCATGTGGAGGTATTGGAATTGCAGCCATCAATGTCTGCCAAAGTATTGGTGGGGTTCAG
GTATATGTAACAGTCGGAAATCAGGATAAAGTTCGATATCTCATGGAGACCTTCAACATTCCGCGTGCCAGCATC
TTTAATTCCCGTGACACCTCCTTCCGAGAGGACGTGCTTGCCCACACTAATGGACGCGGCGTCGATCTCGTGCTC
AACAGCTTGTCGGGTGAGCTTCTTCATGCATCCTGGGAATGTGTAGCTCCGTACGGCAAGATGCTCGAGATCGGC
AAAAGAGACTTTATTGGAAAAGCTAAGTTGAGCATGGACATCTTTGAAGCGAACAGAAGCTTTATCGGTATCGAT
CTCGCCAGATTCGACGCTGCGAGATGTCACCCTCTACTCACTCGTACGGTGCAAATGCTCGAGGCCGGACATATC
AAACCCATCGCACCTAGGACAACCTTCTCTGCTGGTCATATTGAAGACAATTTCCGTTACATGCAGAAAGGGACA
CACATGGGAAAGATCGTCGTGACTATTCCTGAAGGAGGCCGGGAACTGCCAATCGCTCCAATTATCCCAGATTTA
ACCATGAAGGCCAACGCATCATACCTACTCGTGGGAGGAATGGGCGGTCTGGGCCGAGCAGTAGCAACGTGGTTA
GTCGAGAAAGGAGCTAGGCACCTTGTCTTCTTCTCCCGATCAGCCGGAAACTCGGAACAGGACCGACGGTTCATC
CAGGAACTAGAATCGCAAGGATGCAGTGTGAGAGCTATTCAAGGGAGCGTCTTGAATGAGAAGGACGTGGCTCGC
ATCACCCAAGCCACAGAAAAACCAATCAAGGGGGTCTTCCAAATGTCAATGGTACTTCGAGACAAGCCATTCATG
GAAATGGACCTCCAAGACTGGACCACCGCAGTCGGGCCCAAAGTGCAAGGAACGTGGAACCTACACCACGCGATG
CCAAGCGACCTAGACTTCTTCTTCGCAACCGGATCCATCAGCGGGTCCTTTGGAACTCCCGGTCAAGCCAACTAC
GCTGCAGGCAACACATTCCTCAACGCCTTCACACAATACCGGAGAAGTCTGGGTCTGCCCACCTCAATCTTGCAC
ATCGGCCTCATGGACGACGTTGGGTATCTGACTCAGAATGTGGGAAAGGCCGAGGCCCTTCGCGCTGCAGGCGGG
TACTTTCTTCGGGAAAAGGACCTCTTGAATTCTCTTCAGTGGGCTATTGTAAAGGCCACCATAAGCAGTGCGACG
GCAGACAGCGACGAGGCCCAATTGACCATCGGGCTCCGGTGCGACAAGCGACTCTCTGACCCAACAAACCGAGTC
ATATGGAGAAAGGATGCTCGCATGGGACTATACCACAACCGAGACACCGAGTCATCCAGCAGCAGCAATGGTAGT
AACGGTAGTCAAGCGGATGCGCTCAAGGCATTTATGGCATCCGTGGAAGCAGATCCGGAGGTTGTGCTCAAGGAG
CCTGCGTCACTGGAAGTGGTGACGCGGGAAATGGCTGTCAAAATATACACCTTCATGCTACATCCATTGGATGAC
CTGGACGTGAACGTATCGCTAACCGCTTTGGGTGTCGATTCCCTGGTTACAATTGAGATCCGGAACTGGATGAAG
AGAAGTTTAGGCGGCATTGAGATCAGCACATTGGAAATCTTGAATGCGGGGTCCATTGCTAGTTTAGGAAGATTG
GTGATCGAGGCGTTGAAGAAGAAATTTATCTCTCAGATTACGGTGGCAGAAGGGGATGCTTATCTGGAAATGAAG
GCCCCGTGA
Gene >Ani_SJS100_1|g2989.t1
ATGGATAGTCAAGACTCGTCTCCCTGGGAGATCTCCTCTGCGGAGCGCTCGAGTCAGCCGGGAACCCCCGAGGAA
GTTGATTCTTTGGAGCCCATAGCGATTGTTGGCATGGGTCTGAGGCTGCCGGGGAATATCCATACAGAACAGCAG
CTCTGGGAACTCATTACGGAGAAGCGATCCACGCGGGGCGAGATCCCCAAGAGTCGGTTCAACGTGGACGGGTTC
TACAGTCCCACCGGCCGGGCTGGATCGATAGCAATGAAACATGGCCATTTTCTGACAGAGACAGATAATTTCAGA
CATCTGGATACATCTTTCTTCTCGATGGGCCGGAAGGAGGTAGATGACATCGATCCACAGCAACGTATGTTACTT
GAAGTCGTATACGAATGCATGCAATCTTCAGGTCAAGTGGGCTGGCGCGGCAGCAAGATCGGCTGCTACGTTGGA
GTCTGGGGTGAAGTAAGTTGATAAGGACAAGGTTATGAAGATCAAGAGCTGACGCTGAAACCTATCCGCGGTCAG
GATTGGTTGGACCTCCATGCGAAAGATACTCAGGATGCAGGCATGTATCGGATCCCTGGTGGACATGACTTTGCC
ATCTCGAACCGCATTAGCTACGAATACGACTTGAGAGGCCCCTCCTTCACCATAAAGGCCGGGTGCTCATCGTCT
TTGATCGCCTTGCATGACGCTGTTCGAGCCATTCGTGCAGGTGACTGTTCAGGAGCACTTGTTGCAGGCACAAAT
CTCATTTTCTCACCTACAATGTCCATCGCTATGACAGAGCAAGGGGTGCTATCTCCGGATGGCTCTTGCAAGACA
TTTGATGCGGCAGCAAACGGGTACGCCAGGGGCGAAGCCATTAACGCTATCTATGTTAAGTCCCTTTCAGATGCA
ATAAAAGACAACGACAAAATCCGCGCCGTGATCAGAGCTACTGCGACTAATTGTGATGGAAAGACGCCGGGTATG
TCAATGCCCAGCTCTGAAGGCCATGAAGCATTGATCCGTCGAGCATATCGAGAGGCGTCGCTTGACCCCACGGAG
ACCGTGTTTGTCGAAGCACACGGCACAGGCACGCCCGTCGGTGACCCCCTCGAGGCTACGGCAATTGCACGGGTT
TTTGGAGGGAATAATGACCCCGTATATATTGGAAGTGTCAAGCCGAACCTGGGTCATAGCGAGGGCGCTTCCGGA
GTCTCCTCCGTCATTAAGGCCGTGTTGGCATTGGAGAACATGACCATCCCTCCAAATATAAACTTCTCGACTCCG
AACCCAAAGATCCCATTCCAGGAGGCAAACATGGAGGTTCCAATTGACCCAATGACGTGGCCATCCGGTAAACCG
CTGAGAGTGAGTGTGAATTCATTCGGTATTGGGGGCGCAAATGCACACGCCATCCTCGAGAGTGCTGCTCCGATT
TCTTTGCAAGCGACTGTAGCTGCCGCCGCTAGTAGCGAGTATGTGGCCGGAGCCTTGAATGATCGTTATACAAAC
GGTCATACAAACGATCACACAACTCATCCCAAGGACACGGACGAGCCCTGCAGACTGGTGCGTCCTCCTAGTTCT
AGAAGATTCATCCATGTATTCTCAGCAGCACACCCGGCATCCCTAAAAGAAAGCTTAGTCGAGCATGAACGATAC
ATCAGAGAAAATCCTTCTTTGATGACTGATATATCCTACACTTTGTGCAATCGACGAGAGCACTTGGCGAACCGG
GCTTATTGTGTTACCAGTTCCTCAGATGGACCCCTCACGTTCTCGCCTGTTACGAAGACGAAGAGAACATCACCA
ATAACGATGGTATTCACTGGACAAGGGGCACAATGGGCAGGAATGGCCAAGGAGCTGATGGATGACTACCCTTCC
TTTGACAAGGACATAATTTACCTAGGCGCCGTGCTAGCGAAGCTAGAGCACGCCCCATCGTGGGATCTCAGAGAT
GAACTGCGCAAACCAGAAGAAGATAGCAACCTACCCAAAGCGGAGTATTCTCAACCCTTAGTGGCGGCTGTTCAG
GTGGCTTTGGTGAACCTCCTCCGTCAATGGGGCATCCGGCCTAACGCGGTTGTGGGTCACTCAAGCGGAGAGATT
GCAGCGGCATATGCTGCAAAAGCAATCACGGCCGAGGAAGCAATCACAATTGCTTACTACCGCGGGTACATGACG
AAAGGATATCAACGTCTTGGTGGAATGGCTGCTATAGGCCTAGGCCGTGAGCAAGTGACACGATATTTGAGACAG
GGGACATTGATAGCCTGTGAGAACAGTCCGCATAGTGTAACATTGTCAGGGGATCTCGAAGCTCTCGAGAAGACC
TGTGAAATCATTCGGACGGAGGAACCGGGGTGCTTGGTTCGAAGGCTAAAGGTCGAGATGGCCTACCATTCTCGT
ATGTGACCTCAGTCCAGTTCACCAAGTTTGTTTGAGGTTATGGTATACTGACTTTTCACCCACAGACCATATGCT
TGACATTGGCGACTCCCTCGAGGCCCTGCTACGCGATCGCATTGACAGCAAAGCTCCCGTAGTGCCCTTCTTCTC
GAGCGTCCGCGCAACGAGAATAAATGGCGCGGGGGGGTTGAACGCAAGCTATTGGCGAGAAAATCTCGAAAGCCC
CGTACTCTTTTACGGTGCCATAAGTCATTTGGTAGAGAGTGAAGCATGTTCTGAGCACACCTTTCTCGAAGTCGG
CCCACATGGTGCCTTAAGAGGACCGCTCCGTCAAATATTGCAGGCTGCTAATCGGTCCAACGACAGCTACATCAC
AGCCATGATCCGTGGCAAGGACTGCACCGAATCCATCCTGCATATGGCTGGGGAGCTTTACTTGAACAATACACC
AGTGGATTTCGGACATATTTGCCCGAGTGGGTGCCTGCTGACCAATCTTCCATCATACAAATGGCAGCACGTTCA
TGAGTACTGGGCCGAAAGCAGATTGAGCAAAAACTGGAGGTTCCGCGAGTTCCCTCATCATGAACTATTGGGATC
TAGAATACTGGAGGGGAATGATCTGCAGCCCGAATGGCGAAACGTCCTTCGCCTAGAAGATGTACCATGGCTTCG
GGATCATCAAGTCATCAACGATATCATATTCCCCTGCGCAGGGTACCTTGGAATGGCAGGCGAGGCCATCCGACA
GATATCATCTGCCCATGAATTTACCTTCCGGGATGTCGTGGTGCACACAGCATTGGTATTGACCGAGTCAAAGGC
GATTGAGATGATCACTAGTCTTCGTCCGGTCAGGTTGACAACTACCCTGGACTCTGTCTGGTGGGAGTTTAGTAT
ATTCTCATACAATGAGACTGCCTGGGTTAAACATTGCGTGGGACAGATCAGGACGGGGGCTACACATTCTTCGTC
TCCCTTGCCGTGTCCCAGCCATCCCCGTTCAACCGAGAATTTATATCCCATACTGACGAAAGTTGGTCTCAACTA
TGGGCCATGCTTCCGCGGATTATCCCACGTCTCTTGTCTGCCGAACAAGAACACAGCCTCTGCCAGGTTGCTGCC
AACCGCGGTTTCCGAGTCCACCTACGCTGTTCACCCTACGACCATTGATCACTGCCTGCAGCTGTTGTTCCCAGC
TAGCTGTGATGGGATTTACCGGCGTGTAACCCGTTTGTGTGTTCCGACAAAAATCGAACAGCTCTACCTCTGCGG
CGGCAGGAGTGACAATGATGCAGTCGCGGAGGCCGTTGCCACCATCAGTTCTGCTGGCGTTCTTTCCGGAAGAGT
AGTAGCCAAGTCCGATAAGGGAGTTTTCTTGTCCCTAGTCGGAGGGAAGTTTTCTCCCCTCGAGGTGGATACAGC
CGATGATCTTGACCCTATTGGCGCAGCAAAGTTACACTGGAAACCAGATCTCGACCTAGCCGACATGAGGACTTT
GATAAAGGCCAGCGATAGCTCGCATATTGATTCTCTTGAGCTCGAGCTCGTCGAGAAGATGGCCCTACTCAGTCT
CATTGAAGTGAACGTTCAGACATCTCATCTAGTCTGTGATATTGAGCATCTTGAAAAATATCGCTCGTGGATGCA
TCGGCAAACAAGTCGAGCCTCGAGCAATAGCTACGACTTGGTTCCGAATGCTAAGGATTTGCTATCCCTGGATTC
TGATACTAGGCTTGCGTTGATATTCAAGCTGAAACAGTTGTTATCGCACACTGATGCCGCAAGCGCAGCTGAGCT
TATATCCAGGATAGTGGATAACTGCTCTGCTATTATGCAGGGAAAGGTGGAGGGAATCGAAGTACTGCAAGCTCG
CGATGGACTGACCAACTACTACAATTTTGTCGAGTCACGAACTGACTCTGTTGATTTCTTCGCTGTTGCAGGTCA
TACCAAGCCCACGTTGAGAGTGTTGGAAATCGGGGCTGGCACTGGAGGGGGCACAGCAGTTGTCCTGCGGGGCCT
AACCACCTCGTCCACCCCAAGACGTGAGCGTATGTACTCGAAGTACGCTTTTACTGATATCTCTGCTGGGTTCTT
TGTCCCAGCGCAGGAGAGGTTTAAGGAATACGAAGGGATCGAGTATAAGGTACTCGACATTACAAAGGACCCGAT
CGAGCAAGGGTTCCAGGCAGAATCGTACGATTTGATCATCGCAGGCAACGTCTTGCATGCAACTCCCAGTATTAA
TGCAACTCTGGCGAACGTGCGTAAGCTGCTGGCACCTGAGGGCTATCTGTTTCTCCAGGAATTATCGCCCCAGCT
GCAAATGGTGAACCTGTAAGTGTGCTATGTTCCCAGCTACTCCTATCCCAGTGAAAGCTAATTCAGCGAAAATAG
GATTATGGGGATTCTTCCGGGATGGTGGCTGGGCGAAACTGACGGTAGAGTCAATGAGCCGTTTTTGACACCAGA
AGAATGGAACAAGGCATTGAAAATGGCCGGTTTCTCTGGGGTTGAGGCGGCGATCTATGATGGCCCTCGCCCATA
CCACATCAACGCCAATATTATCTCCCGACCTGTACGGGAGTCCATTCTGGGACCTCGTCGTGTTACTCTTCTTCA
CAGTGTTGGCAACGTACCTACAACTAACGTTGACCGCCTCCAGAAGTCTCTTATCGATAATGGTTATCAGGTCGA
CTTGAGAACCCTTCAAGAGGGAGCACCAGCCGATCAAGACATTGTCTCAGTGCTGGAGCTCGAAAGTCCCCTCTT
TGAAAGCGTATCTCATGAAGTCCTATTGGCCTTTCAGGATCTTATTGCCAGTCGAGGAGATAGCAAAATACTATG
GGTCACTAGGCCGGCCCAAAAGGATGTGAGTTCTACTCCGGGGTTCGGTCTGACCCTAGGGCTCGCTCGAACATT
GCGATCGGAACAGTTCCTCTCTTTTATGACCCTGGAAGTCGACCGCGTCGATGACCAGGTTTATCCGGCTATCGT
GCGTGTATTGGGCAAAATCCAATCGCATGACTCGACGGCATCAGTGGATGCAGATTCCGAGTTCATCCTCCGTAA
CGGAGTGGTCCATGTTGGCCGATATCAGCCAGCCTCGGTGGCACAGGACCTGGAACTTATGGCGTCAAAGCCTGG
CGCTGTCAGACTGGCGATTGGTCGTCCAGGTCTGCTACAGTCACTGCAGTGGATTCCTTTCCCCACAACCGAACC
TCGCCATGGGGAAGTTGTCGTTGAGCCTCGTTGTGCAGGCCTAAATTTTAGAGTAAGCGCCACCGCTCTTCCCGT
GATTTCAATTTCTCGTAATTACTGACAAATCTTGGGATTCTAGGATGTGCTTCTCGCTATGGGGATTGTGGAAGC
TAACAACCTTGGCATTGGACTCGAGGGATCGGGCGTGATCACAGACGTAGGTGCCGGAGTGACTGATCTCCAGGT
GGGCGATCGAGTCTTTTACCTCGATGATAACTGCTTCTCTACTCGGATCACCATGTCGGCTATGAGATGTGCGAA
GATCCCATCGTTCCTCTCATACGAAGAAGCGGCCACGATGCCATGTGTTTACGCTACTGTCATTCATTCGCTTGT
GGACATCGGTGGCTTGCAGAGCGGCCAGTCGGTTTTGATACACTCAGCATGTGGAGGTATTGGAATTGCAGCCAT
CAATGTCTGCCAAAGTATTGGTGGGGTTCAGGTAAGCATTTGTTTTCAATGACATGGCTGGACTCACGTGGCGAA
CTAATGCCTGACCATTTTGTGCAGGTATATGTAACAGTCGGAAATCAGGATAAAGTTCGATATCTCATGGAGACC
TTCAACATTCCGCGTGCCAGCATCTTTAATTCCCGTGACACCTCCTTCCGAGAGGACGTGCTTGCCCACACTAAT
GGACGCGGCGTCGATCTCGTGCTCAACAGCTTGTCGGGTGAGCTTCTTCATGCATCCTGGGAATGTGTAGCTCCG
TACGGCAAGATGCTCGAGATCGGCAAAAGAGACTTTATTGGAAAAGCTAAGTTGAGCATGGACATCTTTGAAGCG
AACAGAAGCTTTATCGGTATCGATCTCGCCAGATTCGACGCTGCGAGATGTCACCCGTAAGTCCTATTCTTTCGT
GTACCCCAAGGTCTTTTGTGTTTTAGGAACCACTGTCCTGACCCGACCTAATGATCCCAGTCTACTCACTCGTAC
GGTGCAAATGCTCGAGGCCGGACATATCAAACCCATCGCACCTAGGACAACCTTCTCTGCTGGTCATATTGAAGA
CAATTTCCGTTACATGCAGAAAGGGACACACATGGGAAAGATCGTCGTGACTATTCCTGAAGGAGGCCGGGAACT
GCCAATCGCTCCAATTATCCCAGATTTAACCATGAAGGCCAACGCATCATACCTACTCGTGGGAGGAATGGGCGG
TCTGGGCCGAGCAGTAGCAACGTGGTTAGTCGAGAAAGGAGCTAGGCACCTTGTCTTCTTCTCCCGATCAGCCGG
AAACTCGGAACAGGACCGACGGTTCATCCAGGAACTAGAATCGCAAGGATGCAGTGTGAGAGCTATTCAAGGGAG
CGTCTTGAATGAGAAGGACGTGGCTCGCATCACCCAAGCCACAGAAAAACCAATCAAGGGGGTCTTCCAAATGTC
AATGGTACTTCGAGACAAGCCATTCATGGAAATGGACCTCCAAGACTGGACCACCGCAGTCGGGCCCAAAGTGCA
AGGAACGTGGAACCTACACCACGCGATGCCAAGCGACCTAGACTTCTTCTTCGCAACCGGATCCATCAGCGGGTC
CTTTGGAACTCCCGGTCAAGCCAACTACGCTGCAGGCAACACATTCCTCAACGCCTTCACACAATACCGGAGAAG
TCTGGGTCTGCCCACCTCAATCTTGCACATCGGCCTCATGGACGACGTTGGGTATCTGACTCAGAATGTGGGAAA
GGCCGAGGCCCTTCGCGCTGCAGGCGGGTACTTTCTTCGGGAAAAGGACCTCTTGAATTCTCTTCAGTGGGCTAT
TGTAAAGGCCACCATAAGCAGTGCGACGGCAGACAGCGACGAGGCCCAATTGACCATCGGGCTCCGGTGCGACAA
GCGACTCTCTGACCCAACAAACCGAGTCATATGGAGAAAGGATGCTCGCATGGGACTATACCACAACCGAGACAC
CGAGTCATCCAGCAGCAGCAATGGTAGTAACGGTAGTCAAGCGGATGCGCTCAAGGCATTTATGGCATCCGTGGA
AGCAGATCCGGAGGTTGTGCTCAAGGAGCCTGCGTCACTGGAAGTGGTGACGCGGGAAATGGCTGTCAAAATATA
CACCTTCATGCTACATCCATTGGATGACCTGGACGTGAACGTATCGCTAACCGCTTTGGGTGTCGATTCCCTGGT
TACAATTGAGATCCGGAACTGGATGAAGAGAAGTTTAGGCGGCATTGAGATCAGCACATTGGAAATCTTGAATGC
GGGGTCCATTGCTAGTTTAGGAAGATTGGTGATCGAGGCGTTGAAGAAGAAATTTATCTCTCAGATTACGGTGGC
AGAAGGGGATGCTTATCTGGAAATGAAGGCCCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail