Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g2857.t1
Gene name
Locationscaffold_012:298800..300545
Strand-
Gene length (bp)1745
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.7E-27 11 303
PF00083 Sugar_tr Sugar (and other) transporter 2.6E-08 14 128

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 49 67 18
3 77 99 22
4 106 128 22
5 150 172 22
6 277 294 17
7 328 350 22
8 357 379 22
9 389 411 22
10 420 442 22
11 457 476 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g2857.t1
MVESFHVTDNDRKIALYAGMITSAFTFAEFSAGMFWGRMSDKIGRKPVLIMGLIGTAISMVVFGFAPNLPTAMIA
RALGGLLNGNIGVLQTTVAEIVTVKEHQPRAYSIMPFVWCLGSIIGPAMGGALAQPCDNYPGLFQRDTIFDRFPF
LLPNLVCVVVLVSGIVVGLLFLEETHPEKKHRRDPGLALGNWLVAKVWGSPEPIPEPTDAKAGLAGEEEEEEYYD
YEDVPPPEYRSTESSPRLGPMKESDNLSADDDIEGQMKGEPCATPKAFTKQVIFNIIAYGILAYHSVSFDQLMPV
FLSTPKSDDDVVLPFKFTGGLGLATSKIGFMLAVQGVYSMIAQLWLFPFVVRHFGTLRVFRFVLLVWPPLYLMVP
YLILLPEQLQTAAAYVALISKITLHVIAFPATAILLANAAPSSRVLGSINGAAASTASLSRAFGPTVTGLLHSKG
LESGYSVLAWWACGIVCILGAIESFWMEESERDKDVEKKAECDGPTSNRDSLRGSFTAGKEDGSPEEVRRLLSSA
RTSIDDMDIPNVDSMQANLNVTSEPEPDKSKFSQ*
Coding >Ani_SJS100_1|g2857.t1
ATGGTCGAATCATTCCATGTGACGGATAACGACCGCAAGATCGCCTTGTATGCTGGAATGATTACATCGGCCTTC
ACCTTTGCAGAGTTCTCCGCAGGCATGTTCTGGGGGCGGATGAGTGACAAGATTGGCAGAAAGCCTGTCCTCATC
ATGGGCTTAATTGGGACTGCCATCAGTATGGTCGTTTTTGGGTTCGCTCCCAACTTGCCAACTGCCATGATCGCC
CGGGCACTGGGAGGCCTTCTGAACGGCAACATTGGCGTGCTTCAAACTACCGTTGCAGAGATTGTCACTGTTAAG
GAGCACCAACCCCGGGCCTATTCCATCATGCCGTTCGTCTGGTGCCTTGGGTCGATCATCGGGCCCGCTATGGGT
GGTGCGTTGGCACAACCATGCGACAATTATCCCGGATTATTTCAGCGTGACACCATCTTCGATCGCTTTCCGTTT
CTGCTGCCCAACCTGGTCTGCGTTGTCGTCTTAGTGTCCGGAATCGTTGTTGGCCTGTTGTTCCTGGAGGAGACC
CATCCGGAGAAGAAGCACCGCCGCGATCCCGGCCTGGCGTTGGGCAATTGGCTCGTTGCGAAAGTCTGGGGTTCT
CCCGAACCTATTCCCGAGCCCACGGACGCCAAAGCGGGATTGGCCGGAGAGGAGGAGGAGGAGGAGTACTACGAC
TACGAGGATGTCCCTCCGCCAGAGTACAGGAGCACGGAAAGTTCGCCTCGTCTGGGCCCGATGAAGGAATCGGAC
AACCTGTCTGCGGATGACGACATTGAGGGGCAGATGAAGGGCGAGCCGTGCGCAACCCCCAAGGCATTCACCAAA
CAAGTCATCTTCAACATCATTGCCTATGGCATTCTTGCATACCATAGTGTTTCCTTCGACCAACTCATGCCCGTC
TTCTTGAGCACTCCCAAGTCCGACGACGATGTCGTGCTCCCCTTCAAGTTCACTGGTGGCTTGGGACTGGCTACG
AGTAAAATCGGGTTCATGCTGGCGGTTCAAGGCGTTTATTCCATGATCGCACAGCTGTGGCTGTTCCCGTTTGTT
GTTCGTCACTTTGGAACACTGAGAGTTTTCCGCTTCGTGTTGCTTGTTTGGCCCCCTCTCTACCTCATGGTCCCT
TACCTTATTCTCCTGCCCGAACAGCTGCAAACCGCCGCGGCCTACGTCGCTTTGATCAGCAAAATCACGCTGCAC
GTCATCGCATTCCCTGCTACCGCTATTCTCCTCGCCAACGCTGCTCCGTCTTCCAGAGTCCTCGGTTCCATCAAC
GGCGCGGCCGCCTCGACAGCTAGCTTGAGCCGCGCTTTCGGCCCAACGGTTACTGGCTTGCTTCATTCCAAGGGT
CTCGAAAGTGGATACTCCGTGCTAGCCTGGTGGGCTTGTGGAATAGTATGCATCCTTGGCGCCATCGAGAGCTTT
TGGATGGAGGAATCGGAGCGAGACAAGGACGTGGAGAAGAAGGCCGAATGCGATGGCCCAACTTCGAACCGCGAC
TCGCTGCGGGGTTCCTTCACTGCAGGCAAGGAAGACGGCTCTCCCGAGGAAGTGCGGAGACTGCTTTCTTCGGCG
CGCACCAGCATCGATGACATGGACATTCCCAACGTGGACTCAATGCAAGCCAACCTGAACGTCACTTCCGAGCCC
GAGCCCGACAAGTCCAAGTTCAGCCAATAG
Transcript >Ani_SJS100_1|g2857.t1
ATGGTCGAATCATTCCATGTGACGGATAACGACCGCAAGATCGCCTTGTATGCTGGAATGATTACATCGGCCTTC
ACCTTTGCAGAGTTCTCCGCAGGCATGTTCTGGGGGCGGATGAGTGACAAGATTGGCAGAAAGCCTGTCCTCATC
ATGGGCTTAATTGGGACTGCCATCAGTATGGTCGTTTTTGGGTTCGCTCCCAACTTGCCAACTGCCATGATCGCC
CGGGCACTGGGAGGCCTTCTGAACGGCAACATTGGCGTGCTTCAAACTACCGTTGCAGAGATTGTCACTGTTAAG
GAGCACCAACCCCGGGCCTATTCCATCATGCCGTTCGTCTGGTGCCTTGGGTCGATCATCGGGCCCGCTATGGGT
GGTGCGTTGGCACAACCATGCGACAATTATCCCGGATTATTTCAGCGTGACACCATCTTCGATCGCTTTCCGTTT
CTGCTGCCCAACCTGGTCTGCGTTGTCGTCTTAGTGTCCGGAATCGTTGTTGGCCTGTTGTTCCTGGAGGAGACC
CATCCGGAGAAGAAGCACCGCCGCGATCCCGGCCTGGCGTTGGGCAATTGGCTCGTTGCGAAAGTCTGGGGTTCT
CCCGAACCTATTCCCGAGCCCACGGACGCCAAAGCGGGATTGGCCGGAGAGGAGGAGGAGGAGGAGTACTACGAC
TACGAGGATGTCCCTCCGCCAGAGTACAGGAGCACGGAAAGTTCGCCTCGTCTGGGCCCGATGAAGGAATCGGAC
AACCTGTCTGCGGATGACGACATTGAGGGGCAGATGAAGGGCGAGCCGTGCGCAACCCCCAAGGCATTCACCAAA
CAAGTCATCTTCAACATCATTGCCTATGGCATTCTTGCATACCATAGTGTTTCCTTCGACCAACTCATGCCCGTC
TTCTTGAGCACTCCCAAGTCCGACGACGATGTCGTGCTCCCCTTCAAGTTCACTGGTGGCTTGGGACTGGCTACG
AGTAAAATCGGGTTCATGCTGGCGGTTCAAGGCGTTTATTCCATGATCGCACAGCTGTGGCTGTTCCCGTTTGTT
GTTCGTCACTTTGGAACACTGAGAGTTTTCCGCTTCGTGTTGCTTGTTTGGCCCCCTCTCTACCTCATGGTCCCT
TACCTTATTCTCCTGCCCGAACAGCTGCAAACCGCCGCGGCCTACGTCGCTTTGATCAGCAAAATCACGCTGCAC
GTCATCGCATTCCCTGCTACCGCTATTCTCCTCGCCAACGCTGCTCCGTCTTCCAGAGTCCTCGGTTCCATCAAC
GGCGCGGCCGCCTCGACAGCTAGCTTGAGCCGCGCTTTCGGCCCAACGGTTACTGGCTTGCTTCATTCCAAGGGT
CTCGAAAGTGGATACTCCGTGCTAGCCTGGTGGGCTTGTGGAATAGTATGCATCCTTGGCGCCATCGAGAGCTTT
TGGATGGAGGAATCGGAGCGAGACAAGGACGTGGAGAAGAAGGCCGAATGCGATGGCCCAACTTCGAACCGCGAC
TCGCTGCGGGGTTCCTTCACTGCAGGCAAGGAAGACGGCTCTCCCGAGGAAGTGCGGAGACTGCTTTCTTCGGCG
CGCACCAGCATCGATGACATGGACATTCCCAACGTGGACTCAATGCAAGCCAACCTGAACGTCACTTCCGAGCCC
GAGCCCGACAAGTCCAAGTTCAGCCAATAG
Gene >Ani_SJS100_1|g2857.t1
ATGGTCGAATCATTCCATGTGACGGATAACGACCGCAAGATCGCCTTGTATGCTGGAATGATTACATCGGCCTTC
ACCTTTGCAGAGTTCTCCGCAGGCATGTTCTGGGGGCGGATGAGTGACAAGATTGGCAGAAAGCCTGTCCTCATC
ATGGGCTTAATTGGGACTGCCATCAGTATGGTCGTTTTTGGGTTCGCTCCCAACTTGCCAACTGCCATGATCGCC
CGGGCACTGGGAGGCCTTCTGAACGGCAACATTGGCGTGCTTCAAACTACCGTTGCAGAGATTGTCACTGTTAAG
GAGCACCAACCCCGGGCCTATTCCATCATGCCGTTCGTCTGGTGCCTTGGGTCGATCATCGGGCCCGCTATGGGT
GGTGCGTTGGCACAACCATGCGACAATTATCCCGGATTATTTCAGCGTGACACCATCTTCGATCGCTTTCCGTTT
CTGCTGCCCAACCTGGTCTGCGTTGTCGTCTTAGTGTCCGGAATCGTTGTTGGCCTGTTGTTCCTGGAGGAGACC
CATCCGGAGAAGAAGCACCGCCGCGATCCCGGCCTGGCGTTGGGCAATTGGCTCGTTGCGAAAGTCTGGGGTTCT
CCCGAACCTATTCCCGAGCCCACGGACGCCAAAGCGGGATTGGCCGGAGAGGAGGAGGAGGAGGAGTACTACGAC
TACGAGGATGTCCCTCCGCCAGAGTACAGGAGCACGGAAAGTTCGCCTCGTCTGGGCCCGATGAAGGAATCGGAC
AACCTGTCTGCGGATGACGACATTGAGGGGCAGATGAAGGGCGAGCCGTGCGCAACCCCCAAGGCATTCACCAAA
CAAGTCATCTTCAACATCATTGCCTATGGCATTCTTGCATAGTAAGTCCCCTCTCGTTCCCCACTTCTTCCCCGC
CGTTCTTCAGACGCTGACCTTTACACAACAGCCATAGTGTTTCCTTCGACCAACTCATGCCCGTCTTCTTGAGCA
CTCCCAAGTCCGACGACGATGTCGTGCTCCCCTTCAAGTTCACTGGTGGCTTGGGACTGGCTACGAGTAAAATCG
GGTTCATGCTGGCGGTTCAAGGCGTTTATTCCATGATCGCACAGCTGTGGCTGTTCCCGTTTGTTGTTCGTCACT
TTGGAACACTGAGAGTTTTCCGCTTCGTGTTGCTTGTTTGGCCCCCTCTCTACCTCATGGTCCCTTACCTTATTC
TCCTGCCCGAACAGCTGCAAACCGCCGCGGCCTACGTCGCTTTGATCAGCAAAATCACGCTGCACGTCATCGCAT
TCCCTGCTACCGCTATTCTCCTCGCCAACGCTGCTCCGTCTTCCAGAGTCCTCGGTTCCATCAACGGCGCGGCCG
CCTCGACAGCTAGCTTGAGCCGCGCTTTCGGCCCAACGGTTACTGGCTTGCTTCATTCCAAGGGTCTCGAAAGTG
GATACTCCGTGCTAGCCTGGTGGGCTTGTGGAATAGTATGCATCCTTGGCGCCATCGAGAGCTTTTGGATGGAGG
AATCGGAGCGAGACAAGGACGTGGAGAAGAAGGCCGAATGCGATGGCCCAACTTCGAACCGCGACTCGCTGCGGG
GTTCCTTCACTGCAGGCAAGGAAGACGGCTCTCCCGAGGAAGTGCGGAGACTGCTTTCTTCGGCGCGCACCAGCA
TCGATGACATGGACATTCCCAACGTGGACTCAATGCAAGCCAACCTGAACGTCACTTCCGAGCCCGAGCCCGACA
AGTCCAAGTTCAGCCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail