Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g2779.t1
Gene name
Locationscaffold_012:65625..66639
Strand-
Gene length (bp)1014
Transcript length (bp)1014
Coding sequence length (bp)1014
Protein length (aa) 338

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04199 Cyclase Putative cyclase 1.3E-16 78 271

GO

GO Term Description Terminal node
GO:0004061 arylformamidase activity Yes
GO:0019441 tryptophan catabolic process to kynurenine Yes
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0046700 heterocycle catabolic process No
GO:0044281 small molecule metabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0009056 catabolic process No
GO:0008152 metabolic process No
GO:0006082 organic acid metabolic process No
GO:0009987 cellular process No
GO:0009063 cellular amino acid catabolic process No
GO:0044106 cellular amine metabolic process No
GO:0016787 hydrolase activity No
GO:0006520 cellular amino acid metabolic process No
GO:0042430 indole-containing compound metabolic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0019752 carboxylic acid metabolic process No
GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides No
GO:0009072 aromatic amino acid family metabolic process No
GO:0044238 primary metabolic process No
GO:0006576 cellular biogenic amine metabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0071704 organic substance metabolic process No
GO:0042537 benzene-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009308 amine metabolic process No
GO:0016054 organic acid catabolic process No
GO:0044282 small molecule catabolic process No
GO:1901606 alpha-amino acid catabolic process No
GO:1901575 organic substance catabolic process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0006568 tryptophan metabolic process No
GO:0070189 kynurenine metabolic process No
GO:0042402 cellular biogenic amine catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0046218 indolalkylamine catabolic process No
GO:0006586 indolalkylamine metabolic process No
GO:0042180 cellular ketone metabolic process No
GO:0046395 carboxylic acid catabolic process No
GO:0009310 amine catabolic process No
GO:0006569 tryptophan catabolic process No
GO:0044248 cellular catabolic process No
GO:0003824 catalytic activity No
GO:0046483 heterocycle metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0009074 aromatic amino acid family catabolic process No
GO:0043436 oxoacid metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0042436 indole-containing compound catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g2779.t1
MPFHNKPAFDDLPLDKTGPPGNAWGLFGPNDQCGMLNLLTPDRTCAAASEIRDGVRISTDWPLDRISTPAFNRIP
FTQTISNIAPTSVNDDILHFNTQASSQWDGLRHFGYQEQRLYFNARTLDDILTTKVNGIHGAYFLPKIMIPDRFV
LTVRAAWVETGGIIGRGVLLDYVAWAEANHVPVKPFTTQSITVAVLEEVAQAQGTELRPGDILFIRAGWGRGYAE
LSQDEISTLAEIPTPPAIGLESSEATLRWLWDKEFAAVASDTPSLEAWPCQDSKYWLHEWLLAGWGLPIGEMFDL
EQLSVECRKRQRWSFFFTSVPLKVRYIADCDLFIRNH*
Coding >Ani_SJS100_1|g2779.t1
ATGCCGTTCCACAACAAGCCCGCCTTCGATGACCTGCCCCTCGATAAGACGGGTCCACCCGGTAATGCATGGGGA
TTATTTGGACCCAACGACCAGTGTGGCATGTTGAATCTCCTCACCCCCGATCGAACCTGTGCCGCCGCGAGCGAA
ATCCGCGATGGGGTTCGCATCTCCACCGACTGGCCGTTAGATCGCATTTCCACGCCCGCCTTCAATCGCATCCCG
TTCACCCAGACCATCTCCAACATCGCCCCCACCTCTGTCAACGATGACATCCTGCACTTCAACACCCAGGCCAGC
TCGCAGTGGGACGGGCTGCGGCATTTTGGCTACCAGGAACAGCGACTGTATTTCAACGCCCGTACCCTTGACGAC
ATTCTGACTACCAAGGTCAATGGGATTCACGGTGCGTATTTCCTTCCGAAGATCATGATCCCGGATAGGTTTGTT
CTGACGGTTCGTGCAGCATGGGTGGAAACCGGTGGCATCATCGGACGGGGAGTCCTGTTAGATTATGTCGCTTGG
GCGGAGGCCAACCATGTCCCTGTGAAGCCTTTCACGACCCAGTCAATCACAGTCGCTGTTCTAGAGGAAGTCGCC
CAGGCCCAGGGTACAGAATTGAGGCCTGGTGATATCCTGTTCATCCGAGCAGGCTGGGGACGGGGATATGCAGAA
CTATCTCAAGACGAAATCTCTACGCTGGCCGAGATCCCCACACCTCCAGCTATCGGACTCGAGTCCTCGGAGGCC
ACCCTCCGGTGGCTCTGGGACAAGGAGTTTGCCGCTGTCGCTAGTGACACCCCGAGCCTTGAGGCCTGGCCGTGC
CAGGACTCCAAGTACTGGCTACATGAGTGGCTGCTGGCCGGCTGGGGGCTTCCGATCGGGGAGATGTTCGATTTG
GAGCAGTTGAGTGTTGAGTGTCGCAAGAGGCAGCGCTGGTCATTCTTCTTCACCAGCGTTCCATTAAAGGTGCGT
TATATTGCCGATTGTGATCTGTTTATCCGTAATCATTAA
Transcript >Ani_SJS100_1|g2779.t1
ATGCCGTTCCACAACAAGCCCGCCTTCGATGACCTGCCCCTCGATAAGACGGGTCCACCCGGTAATGCATGGGGA
TTATTTGGACCCAACGACCAGTGTGGCATGTTGAATCTCCTCACCCCCGATCGAACCTGTGCCGCCGCGAGCGAA
ATCCGCGATGGGGTTCGCATCTCCACCGACTGGCCGTTAGATCGCATTTCCACGCCCGCCTTCAATCGCATCCCG
TTCACCCAGACCATCTCCAACATCGCCCCCACCTCTGTCAACGATGACATCCTGCACTTCAACACCCAGGCCAGC
TCGCAGTGGGACGGGCTGCGGCATTTTGGCTACCAGGAACAGCGACTGTATTTCAACGCCCGTACCCTTGACGAC
ATTCTGACTACCAAGGTCAATGGGATTCACGGTGCGTATTTCCTTCCGAAGATCATGATCCCGGATAGGTTTGTT
CTGACGGTTCGTGCAGCATGGGTGGAAACCGGTGGCATCATCGGACGGGGAGTCCTGTTAGATTATGTCGCTTGG
GCGGAGGCCAACCATGTCCCTGTGAAGCCTTTCACGACCCAGTCAATCACAGTCGCTGTTCTAGAGGAAGTCGCC
CAGGCCCAGGGTACAGAATTGAGGCCTGGTGATATCCTGTTCATCCGAGCAGGCTGGGGACGGGGATATGCAGAA
CTATCTCAAGACGAAATCTCTACGCTGGCCGAGATCCCCACACCTCCAGCTATCGGACTCGAGTCCTCGGAGGCC
ACCCTCCGGTGGCTCTGGGACAAGGAGTTTGCCGCTGTCGCTAGTGACACCCCGAGCCTTGAGGCCTGGCCGTGC
CAGGACTCCAAGTACTGGCTACATGAGTGGCTGCTGGCCGGCTGGGGGCTTCCGATCGGGGAGATGTTCGATTTG
GAGCAGTTGAGTGTTGAGTGTCGCAAGAGGCAGCGCTGGTCATTCTTCTTCACCAGCGTTCCATTAAAGGTGCGT
TATATTGCCGATTGTGATCTGTTTATCCGTAATCATTAA
Gene >Ani_SJS100_1|g2779.t1
ATGCCGTTCCACAACAAGCCCGCCTTCGATGACCTGCCCCTCGATAAGACGGGTCCACCCGGTAATGCATGGGGA
TTATTTGGACCCAACGACCAGTGTGGCATGTTGAATCTCCTCACCCCCGATCGAACCTGTGCCGCCGCGAGCGAA
ATCCGCGATGGGGTTCGCATCTCCACCGACTGGCCGTTAGATCGCATTTCCACGCCCGCCTTCAATCGCATCCCG
TTCACCCAGACCATCTCCAACATCGCCCCCACCTCTGTCAACGATGACATCCTGCACTTCAACACCCAGGCCAGC
TCGCAGTGGGACGGGCTGCGGCATTTTGGCTACCAGGAACAGCGACTGTATTTCAACGCCCGTACCCTTGACGAC
ATTCTGACTACCAAGGTCAATGGGATTCACGGTGCGTATTTCCTTCCGAAGATCATGATCCCGGATAGGTTTGTT
CTGACGGTTCGTGCAGCATGGGTGGAAACCGGTGGCATCATCGGACGGGGAGTCCTGTTAGATTATGTCGCTTGG
GCGGAGGCCAACCATGTCCCTGTGAAGCCTTTCACGACCCAGTCAATCACAGTCGCTGTTCTAGAGGAAGTCGCC
CAGGCCCAGGGTACAGAATTGAGGCCTGGTGATATCCTGTTCATCCGAGCAGGCTGGGGACGGGGATATGCAGAA
CTATCTCAAGACGAAATCTCTACGCTGGCCGAGATCCCCACACCTCCAGCTATCGGACTCGAGTCCTCGGAGGCC
ACCCTCCGGTGGCTCTGGGACAAGGAGTTTGCCGCTGTCGCTAGTGACACCCCGAGCCTTGAGGCCTGGCCGTGC
CAGGACTCCAAGTACTGGCTACATGAGTGGCTGCTGGCCGGCTGGGGGCTTCCGATCGGGGAGATGTTCGATTTG
GAGCAGTTGAGTGTTGAGTGTCGCAAGAGGCAGCGCTGGTCATTCTTCTTCACCAGCGTTCCATTAAAGGTGCGT
TATATTGCCGATTGTGATCTGTTTATCCGTAATCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail