Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g2735.t1
Gene name
Locationscaffold_011:471023..472693
Strand-
Gene length (bp)1670
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02133 Transp_cyt_pur Permease for cytosine/purines, uracil, thiamine, allantoin 9.5E-31 59 463

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22
2 100 122 22
3 135 157 22
4 177 199 22
5 206 228 22
6 243 265 22
7 277 299 22
8 333 355 22
9 367 386 19
10 401 420 19
11 441 460 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g2735.t1
MDFKTLEDGHPIEPKQATASVEEHALVKPSGFFARIRYYEELLDQKMGVESHSLDRVLPEERKPPNTLAMAFIWA
SATMNLSCFSTGFMGKEFGLTLGQTIAIMICATFLGAALTGWCATMGPGTGLRQVAISRYSFGFYPSSIIAALNV
VEQLGWASVSCITGGQALRAVSDNHISMVVGVVIVACVSLCFSFFGLRAVMTIEQYIWMVSFVVFIIVYGESAHH
ASLSDPGTVSGLTKSGNVLSLISVIYGSSASWCSIVSDFYVHYPVNTSKVKVFIYTTLGISLPTCIGMLLGACIA
SALDGNPEWAAAYDQGTGEILQTIIYPRKFAKFLLVLLVLCGIGMNCIAIYAGSLSAQLFAKPFQKIPRIIWTLL
VFACILVIGIAGRDHLLTVLDNFLSLLGYWNTSFFVILFCEHYFFRNGNLANYDLDAWNTPSKLPVGYAGLTAFL
CGAAGWIVGMDETYYVGALARKIGTDGGDIANELAFVFTSLSYIPLRKLELKYVGR*
Coding >Ani_SJS100_1|g2735.t1
ATGGATTTCAAAACCCTTGAGGATGGCCACCCCATCGAACCGAAGCAGGCCACCGCTTCGGTGGAGGAACACGCC
CTGGTTAAACCTAGCGGTTTCTTCGCCCGCATCCGCTACTATGAAGAGCTGTTGGATCAGAAAATGGGCGTCGAG
TCCCACAGTCTCGATCGAGTCCTGCCCGAAGAGCGCAAACCGCCCAACACCTTGGCCATGGCCTTTATCTGGGCA
TCGGCCACCATGAACCTCAGTTGTTTCAGTACGGGATTTATGGGGAAGGAGTTTGGCTTGACCCTAGGGCAGACG
ATCGCCATTATGATTTGCGCGACGTTTCTCGGCGCTGCTCTCACGGGTTGGTGTGCCACGATGGGCCCTGGCACT
GGCCTTCGTCAAGTCGCCATCTCTAGATACTCCTTTGGCTTCTACCCCTCCTCCATCATCGCGGCGCTGAATGTC
GTCGAACAGCTGGGCTGGGCCTCTGTCAGCTGTATTACTGGTGGTCAAGCTCTTCGTGCCGTTTCGGACAATCAC
ATTTCCATGGTCGTGGGAGTCGTCATTGTTGCATGCGTTAGTTTGTGTTTCAGCTTCTTCGGTCTTAGGGCTGTT
ATGACCATTGAGCAATACATTTGGATGGTTTCCTTTGTCGTCTTCATCATCGTCTACGGTGAATCGGCCCACCAC
GCCAGCCTGTCAGATCCCGGTACCGTGTCCGGGCTGACCAAGTCCGGAAATGTTCTGAGCCTGATCAGCGTTATC
TATGGCTCGAGTGCATCGTGGTGCTCGATCGTGTCTGACTTTTATGTGCACTACCCGGTCAACACCTCGAAGGTC
AAGGTCTTCATCTACACCACCCTGGGTATTTCACTCCCGACTTGTATCGGAATGTTGCTCGGTGCGTGTATCGCA
TCTGCCCTGGACGGAAACCCAGAATGGGCTGCTGCCTATGACCAAGGAACTGGAGAGATCTTGCAGACCATCATC
TATCCCCGCAAATTTGCTAAGTTCCTCTTGGTCTTGCTGGTGCTGTGTGGCATCGGTATGAACTGCATTGCCATT
TATGCTGGATCCCTTTCGGCACAATTATTCGCCAAACCCTTCCAGAAGATCCCCCGAATTATTTGGACACTACTC
GTGTTCGCCTGCATTCTTGTCATTGGTATCGCAGGCCGGGACCACCTGCTGACTGTCCTGGATAATTTTCTCTCC
CTCTTGGGTTACTGGAACACCTCCTTTTTCGTCATTTTGTTCTGCGAACACTACTTCTTCCGCAACGGCAACCTG
GCCAACTACGACCTCGACGCCTGGAACACGCCGTCGAAACTGCCCGTCGGCTACGCCGGTCTCACAGCGTTCCTG
TGCGGTGCGGCCGGTTGGATCGTCGGCATGGACGAAACGTATTATGTTGGAGCGCTGGCGCGCAAGATTGGCACC
GATGGAGGAGACATTGCCAATGAGCTGGCGTTTGTTTTTACTAGCTTGTCGTATATTCCCTTGCGGAAGCTGGAG
TTGAAGTACGTTGGACGGTAG
Transcript >Ani_SJS100_1|g2735.t1
ATGGATTTCAAAACCCTTGAGGATGGCCACCCCATCGAACCGAAGCAGGCCACCGCTTCGGTGGAGGAACACGCC
CTGGTTAAACCTAGCGGTTTCTTCGCCCGCATCCGCTACTATGAAGAGCTGTTGGATCAGAAAATGGGCGTCGAG
TCCCACAGTCTCGATCGAGTCCTGCCCGAAGAGCGCAAACCGCCCAACACCTTGGCCATGGCCTTTATCTGGGCA
TCGGCCACCATGAACCTCAGTTGTTTCAGTACGGGATTTATGGGGAAGGAGTTTGGCTTGACCCTAGGGCAGACG
ATCGCCATTATGATTTGCGCGACGTTTCTCGGCGCTGCTCTCACGGGTTGGTGTGCCACGATGGGCCCTGGCACT
GGCCTTCGTCAAGTCGCCATCTCTAGATACTCCTTTGGCTTCTACCCCTCCTCCATCATCGCGGCGCTGAATGTC
GTCGAACAGCTGGGCTGGGCCTCTGTCAGCTGTATTACTGGTGGTCAAGCTCTTCGTGCCGTTTCGGACAATCAC
ATTTCCATGGTCGTGGGAGTCGTCATTGTTGCATGCGTTAGTTTGTGTTTCAGCTTCTTCGGTCTTAGGGCTGTT
ATGACCATTGAGCAATACATTTGGATGGTTTCCTTTGTCGTCTTCATCATCGTCTACGGTGAATCGGCCCACCAC
GCCAGCCTGTCAGATCCCGGTACCGTGTCCGGGCTGACCAAGTCCGGAAATGTTCTGAGCCTGATCAGCGTTATC
TATGGCTCGAGTGCATCGTGGTGCTCGATCGTGTCTGACTTTTATGTGCACTACCCGGTCAACACCTCGAAGGTC
AAGGTCTTCATCTACACCACCCTGGGTATTTCACTCCCGACTTGTATCGGAATGTTGCTCGGTGCGTGTATCGCA
TCTGCCCTGGACGGAAACCCAGAATGGGCTGCTGCCTATGACCAAGGAACTGGAGAGATCTTGCAGACCATCATC
TATCCCCGCAAATTTGCTAAGTTCCTCTTGGTCTTGCTGGTGCTGTGTGGCATCGGTATGAACTGCATTGCCATT
TATGCTGGATCCCTTTCGGCACAATTATTCGCCAAACCCTTCCAGAAGATCCCCCGAATTATTTGGACACTACTC
GTGTTCGCCTGCATTCTTGTCATTGGTATCGCAGGCCGGGACCACCTGCTGACTGTCCTGGATAATTTTCTCTCC
CTCTTGGGTTACTGGAACACCTCCTTTTTCGTCATTTTGTTCTGCGAACACTACTTCTTCCGCAACGGCAACCTG
GCCAACTACGACCTCGACGCCTGGAACACGCCGTCGAAACTGCCCGTCGGCTACGCCGGTCTCACAGCGTTCCTG
TGCGGTGCGGCCGGTTGGATCGTCGGCATGGACGAAACGTATTATGTTGGAGCGCTGGCGCGCAAGATTGGCACC
GATGGAGGAGACATTGCCAATGAGCTGGCGTTTGTTTTTACTAGCTTGTCGTATATTCCCTTGCGGAAGCTGGAG
TTGAAGTACGTTGGACGGTAG
Gene >Ani_SJS100_1|g2735.t1
ATGGATTTCAAAACCCTTGAGGATGGCCACCCCATCGAACCGAAGCAGGCCACCGCTTCGGTGGAGGAACACGCC
CTGGTTAAACCTAGCGGTTTCTTCGCCCGCATCCGCTACTATGAAGAGCTGTTGGATCAGAAAATGGGCGTCGAG
TCCCACAGTCTCGATCGAGTCCTGCCCGAAGAGCGCAAACCGCCCAACACCTTGGCCATGGCCTTTATCTGGGCA
TCGGCCACCATGAACCTCAGTTGTTTCAGTACGGGATTTATGGGGAAGGAGTTTGGCTTGACCCTAGGGCAGACG
ATCGCCATTATGATTTGCGCGACGTTTCTCGGCGCTGCTCTCACGGTTCGCATACCACTTTCTCTACCTATCTTT
TGCTGCGACGCAATGCGGCGCACTCATCTTAGGGTCTGTCCAAAGGCTTACATGTCGGTTCACTAGGGTTGGTGT
GCCACGATGGGCCCTGGCACTGGCCTTCGTCAAGTCGCCATCTCTAGATACTCCTTTGGCTTCTACCCCTCCTCC
ATCATCGCGGCGCTGAATGTCGTCGAACAGCTGGGCTGGGCCTCTGTCAGCTGTATTACTGGTGGTCAAGCTCTT
CGTGCCGTTTCGGACAATCACATTTCCATGGTCGTGGGAGTCGTCATTGTTGCATGCGTTAGTTTGTGTTTCAGC
TTCTTCGGTCTTAGGGCTGTTATGACCATTGAGCAATACATTTGGATGGTTTCCTTTGTCGTCTTCATCATCGTC
TACGGTGAATCGGCCCACCACGCCAGCCTGTCAGATCCCGGTACCGTGTCCGGGCTGACCAAGTCCGGAAATGTT
CTGAGCCTGATCAGCGTTATCTATGGCTCGAGTGCATCGTGGTGCTCGATCGTGTCTGACTTTTATGTGCACTAC
CCGGTCAACACCTCGAAGGTCAAGGTCTTCATCTACACCACCCTGGGTATTTCACTCCCGACTTGTATCGGAATG
TTGCTCGGTGCGTGTATCGCATCTGCCCTGGACGGAAACCCAGAATGGGCTGCTGCCTATGACCAAGGAACTGGA
GAGATCTTGCAGACCATCATCTATCCCCGCAAATTTGCTAAGTTCCTCTTGGTCTTGCTGGTGCTGTGTGGCAGT
AAGTATACCCACTTACCTCACGTCATAACCGCTACTAACACTACAATATAGTCGGTATGAACTGCATTGCCATTT
ATGCTGGATCCCTTTCGGCACAATTATTCGCCAAACCCTTCCAGAAGATCCCCCGAATTATTTGGACACTACTCG
TGTTCGCCTGCATTCTTGTCATTGGTATCGCAGGCCGGGACCACCTGCTGACTGTCCTGGATAATTTTCTCTCCC
TCTTGGGTTACTGGAACACCTCCTTTTTCGTCATTTTGTTCTGCGAACACTACTTCTTCCGCAACGGCAACCTGG
CCAACTACGACCTCGACGCCTGGAACACGCCGTCGAAACTGCCCGTCGGCTACGCCGGTCTCACAGCGTTCCTGT
GCGGTGCGGCCGGTTGGATCGTCGGCATGGACGAAACGTATTATGTTGGAGCGCTGGCGCGCAAGATTGGCACCG
ATGGAGGAGACATTGCCAATGAGCTGGCGTTTGTTTTTACTAGCTTGTCGTATATTCCCTTGCGGAAGCTGGAGT
TGAAGTACGTTGGACGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail