Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g2733.t1
Gene name
Locationscaffold_011:459224..461546
Strand-
Gene length (bp)2322
Transcript length (bp)1839
Coding sequence length (bp)1839
Protein length (aa) 613

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00790 VHS VHS domain 3.0E-36 5 140
PF00018 SH3_1 SH3 domain 6.4E-16 222 266
PF14604 SH3_9 Variant SH3 domain 1.9E-14 223 271
PF07653 SH3_2 Variant SH3 domain 1.1E-13 220 272
PF03127 GAT GAT domain 8.2E-10 296 367

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0043130 ubiquitin binding Yes
GO:0035091 phosphatidylinositol binding Yes
GO:0008289 lipid binding No
GO:0032182 ubiquitin-like protein binding No
GO:0005488 binding No
GO:0005543 phospholipid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g2733.t1
MFRAQQNAFDDAVAKATDENLTSENWEYILDVCDKVGAEESGAKDAVAAMIKRLAHRNANVQLYTLELANALAQN
CGPKIHRELASRSFTDALLRLANDRNTHQQVKSKILERMQEWTEMFASNPDFGIMEQAYMKLKTQNPNLQPPSKP
GKREITDADRQKEEEELQMALALSIREKATIAPAPQAEASSSAAPVNQTQAPAATSQAVPSGTSAATVSRVRALF
DFQPSEPGELQFRKGDVIAVLESVYKDWWKGSLRGQTGIFPLNYVEKLPDPTVEELQREAQMEADVFGQIKNVEK
LLTLLSTRSSELNVQDNEEITALYHSTLAIRPKLIELIGKYSQKKDEFTQLNEKFIKARRDYESLLEASMAHPAQ
SQYGRPAQPPYGYPGAAPVGYPQGPPQADPQRYFSPRPQAETQAPPANAPAFYGTEQAHAYPPTSQSPDPRQTPP
AGAPYQQPQPQQQRQPSSESYQPVYHRPESTYENPQELGTSVYDSPVEHPASQRPPYPGAVQVPAAVQQHFQQQQ
QQPQQQSQQPHPEYPASGYTPEDASRPPAHQAQPPYPSHQPPPMHQPPPVPGTSTTPTPYPALNAGGGYQAYNPS
QTDVSNPASFYR*
Coding >Ani_SJS100_1|g2733.t1
ATGTTTCGCGCACAGCAAAACGCCTTTGACGATGCAGTCGCCAAGGCGACCGACGAGAACCTGACCTCCGAAAAC
TGGGAATACATCCTGGATGTTTGCGATAAAGTTGGTGCCGAGGAGTCAGGAGCGAAAGATGCTGTCGCCGCTATG
ATCAAGAGACTTGCGCACAGAAACGCCAATGTGCAGCTTTATACTTTGGAGTTGGCGAACGCCCTCGCTCAGAAC
TGCGGTCCCAAGATTCATCGTGAGTTGGCTTCTAGGAGCTTCACCGATGCTCTGCTACGTCTAGCGAATGACAGA
AACACCCATCAACAGGTCAAGTCGAAGATCCTAGAACGCATGCAAGAATGGACGGAGATGTTCGCCAGTAACCCA
GATTTCGGAATCATGGAACAAGCATACATGAAGCTGAAGACTCAGAACCCGAACCTGCAGCCACCGTCCAAGCCC
GGGAAGCGGGAAATTACCGATGCAGATCGCCAAAAGGAAGAGGAGGAGCTGCAAATGGCCCTCGCACTCTCGATA
AGAGAAAAGGCCACGATCGCCCCTGCGCCACAGGCTGAAGCCAGCTCCAGCGCTGCTCCAGTCAACCAAACCCAG
GCACCTGCTGCCACCTCCCAAGCAGTCCCGTCGGGTACTTCTGCCGCCACAGTGTCGCGCGTGAGAGCCCTGTTC
GACTTTCAGCCTTCAGAACCCGGTGAATTGCAGTTCCGCAAGGGAGATGTCATCGCTGTCCTCGAGTCCGTCTAC
AAGGATTGGTGGAAGGGTTCCTTGAGAGGCCAGACCGGCATCTTCCCCCTTAACTACGTTGAGAAACTTCCTGAC
CCGACGGTGGAGGAGTTGCAGCGGGAAGCCCAGATGGAAGCCGATGTTTTCGGTCAGATTAAGAATGTGGAAAAG
CTGTTGACTCTTCTGAGCACTCGGAGCTCCGAGCTGAATGTGCAGGACAATGAAGAAATCACGGCCCTGTATCAC
TCTACATTGGCCATTCGCCCCAAGTTGATTGAGCTCATTGGGAAATACTCGCAGAAAAAGGACGAGTTCACGCAG
CTCAACGAGAAGTTCATCAAGGCGCGGAGAGATTACGAGTCTCTGCTGGAGGCGTCCATGGCGCACCCAGCACAA
TCCCAGTATGGCCGGCCGGCTCAACCTCCTTACGGCTATCCTGGTGCTGCTCCTGTGGGATATCCTCAAGGGCCG
CCACAAGCTGATCCTCAACGCTACTTCAGTCCCCGTCCTCAAGCAGAAACACAAGCCCCTCCGGCCAACGCGCCC
GCATTCTACGGCACAGAACAAGCACACGCATATCCTCCCACTTCACAATCGCCTGATCCCCGTCAGACACCACCT
GCTGGCGCTCCGTATCAGCAGCCGCAGCCACAGCAGCAACGTCAACCCTCCTCGGAGTCCTACCAGCCCGTGTAC
CACCGTCCGGAATCCACATACGAGAATCCGCAAGAACTCGGCACATCGGTCTACGATTCCCCGGTCGAGCATCCT
GCCAGCCAGCGACCACCATATCCCGGCGCCGTGCAGGTCCCGGCCGCCGTGCAGCAGCATTTCCAACAGCAACAG
CAGCAGCCGCAACAGCAGTCACAACAACCACACCCGGAATACCCGGCCTCAGGCTACACTCCTGAAGACGCCTCC
AGACCCCCTGCCCACCAAGCACAGCCTCCTTACCCTTCACACCAACCGCCGCCTATGCACCAGCCCCCGCCTGTC
CCAGGTACATCCACAACGCCGACACCTTATCCTGCTCTGAACGCGGGCGGAGGATACCAGGCATATAACCCGTCT
CAAACGGATGTATCTAACCCAGCGTCGTTCTACCGGTGA
Transcript >Ani_SJS100_1|g2733.t1
ATGTTTCGCGCACAGCAAAACGCCTTTGACGATGCAGTCGCCAAGGCGACCGACGAGAACCTGACCTCCGAAAAC
TGGGAATACATCCTGGATGTTTGCGATAAAGTTGGTGCCGAGGAGTCAGGAGCGAAAGATGCTGTCGCCGCTATG
ATCAAGAGACTTGCGCACAGAAACGCCAATGTGCAGCTTTATACTTTGGAGTTGGCGAACGCCCTCGCTCAGAAC
TGCGGTCCCAAGATTCATCGTGAGTTGGCTTCTAGGAGCTTCACCGATGCTCTGCTACGTCTAGCGAATGACAGA
AACACCCATCAACAGGTCAAGTCGAAGATCCTAGAACGCATGCAAGAATGGACGGAGATGTTCGCCAGTAACCCA
GATTTCGGAATCATGGAACAAGCATACATGAAGCTGAAGACTCAGAACCCGAACCTGCAGCCACCGTCCAAGCCC
GGGAAGCGGGAAATTACCGATGCAGATCGCCAAAAGGAAGAGGAGGAGCTGCAAATGGCCCTCGCACTCTCGATA
AGAGAAAAGGCCACGATCGCCCCTGCGCCACAGGCTGAAGCCAGCTCCAGCGCTGCTCCAGTCAACCAAACCCAG
GCACCTGCTGCCACCTCCCAAGCAGTCCCGTCGGGTACTTCTGCCGCCACAGTGTCGCGCGTGAGAGCCCTGTTC
GACTTTCAGCCTTCAGAACCCGGTGAATTGCAGTTCCGCAAGGGAGATGTCATCGCTGTCCTCGAGTCCGTCTAC
AAGGATTGGTGGAAGGGTTCCTTGAGAGGCCAGACCGGCATCTTCCCCCTTAACTACGTTGAGAAACTTCCTGAC
CCGACGGTGGAGGAGTTGCAGCGGGAAGCCCAGATGGAAGCCGATGTTTTCGGTCAGATTAAGAATGTGGAAAAG
CTGTTGACTCTTCTGAGCACTCGGAGCTCCGAGCTGAATGTGCAGGACAATGAAGAAATCACGGCCCTGTATCAC
TCTACATTGGCCATTCGCCCCAAGTTGATTGAGCTCATTGGGAAATACTCGCAGAAAAAGGACGAGTTCACGCAG
CTCAACGAGAAGTTCATCAAGGCGCGGAGAGATTACGAGTCTCTGCTGGAGGCGTCCATGGCGCACCCAGCACAA
TCCCAGTATGGCCGGCCGGCTCAACCTCCTTACGGCTATCCTGGTGCTGCTCCTGTGGGATATCCTCAAGGGCCG
CCACAAGCTGATCCTCAACGCTACTTCAGTCCCCGTCCTCAAGCAGAAACACAAGCCCCTCCGGCCAACGCGCCC
GCATTCTACGGCACAGAACAAGCACACGCATATCCTCCCACTTCACAATCGCCTGATCCCCGTCAGACACCACCT
GCTGGCGCTCCGTATCAGCAGCCGCAGCCACAGCAGCAACGTCAACCCTCCTCGGAGTCCTACCAGCCCGTGTAC
CACCGTCCGGAATCCACATACGAGAATCCGCAAGAACTCGGCACATCGGTCTACGATTCCCCGGTCGAGCATCCT
GCCAGCCAGCGACCACCATATCCCGGCGCCGTGCAGGTCCCGGCCGCCGTGCAGCAGCATTTCCAACAGCAACAG
CAGCAGCCGCAACAGCAGTCACAACAACCACACCCGGAATACCCGGCCTCAGGCTACACTCCTGAAGACGCCTCC
AGACCCCCTGCCCACCAAGCACAGCCTCCTTACCCTTCACACCAACCGCCGCCTATGCACCAGCCCCCGCCTGTC
CCAGGTACATCCACAACGCCGACACCTTATCCTGCTCTGAACGCGGGCGGAGGATACCAGGCATATAACCCGTCT
CAAACGGATGTATCTAACCCAGCGTCGTTCTACCGGTGA
Gene >Ani_SJS100_1|g2733.t1
ATGTTTCGCGCACAGCAAAACGCCTTTGACGATGCAGTCGGTATGAAACACACATCCTCTGTTGCACGCCGTGCA
GCTCTACTCTCCTATACTTGTTGCTAACCCGAGCGATGTGGTATAGCCAAGGCGACCGACGAGAACCTGACCTCC
GAAAACTGGGAATACATCCTGGTACGCAAACCCCACGATCGTTAAATCTGCCATGAATCGGCCGAAAGATATATA
TCTGACTGGAGCTTTTGGTTGTGTTTAGGATGTTTGCGATAAAGTTGGTGCCGAGGAGTCAGGGTATGTTTCGCC
GTTCGGTTGTCCTCTTCGGTGCACGTCATTCTGACAGTGGATTTGTTTCTAGAGCGAAAGATGCTGTCGCCGCTA
TGATCAAGAGACTTGCGCACAGAAACGCCAATGTGCAGCTTTATACTTTGGAGGTTCGTGCTGGATCCGGTGGCA
TGCCCGAGTTTTGCGGGCTTACGTGTACTGATATGGCTATAGTTGGCGAACGCCCTCGCTCAGAACTGCGGTCCC
AAGATTCATCGTGAGTTGGCTTCTAGGAGCTTCACCGATGCTCTGCTACGTCTAGCGAATGACAGAGTAAGTTGG
ACTTTCACGGATGAAGAGCATCGCACTTATACAGAGCAGAACACCCATCAACAGGTCAAGTCGAAGATCCTAGAA
CGCATGCAAGAATGGACGGAGATGTTCGCCAGTAACCCAGATTTCGGAATCATGGAACAAGCATACATGAAGCTG
AAGACTCAGAGTAAGATCGTTAGCAGCTATGAATGTTGAAGAGAAACTCACTATCTTAGACCCGAACCTGCAGCC
ACCGTCCAAGCCCGGGAAGCGGGAAATTACCGATGCAGATCGCCAAAAGGAAGAGGAGGAGCTGCAAATGGCCCT
CGCACTCTCGATAAGAGAAAAGGCCACGATCGCCCCTGCGCCACAGGCTGAAGCCAGCTCCAGCGCTGCTCCAGT
CAACCAAACCCAGGCACCTGCTGCCACCTCCCAAGCAGTCCCGTCGGGTACTTCTGCCGCCACAGTGTCGCGCGT
GAGAGCCCTGTTCGACTTTCAGCCTTCAGAACCCGGTGAATTGCAGTTCCGCAAGGGAGATGTCATCGCTGTCCT
CGAGTCCGTCTACAAGGATTGGTGGAAGGGTTCCTTGAGAGGCCAGACCGGCATCTTCCCCCTTAACTACGTTGA
GAAACTTCCTGACCCGACGGTGGAGGAGTTGCAGCGGGAAGCCCAGATGGAAGCCGATGTTTTCGGTCAGATTAA
GAATGTGGAAAAGCTGTTGACTCTTCTGAGCACTCGGAGCTCCGAGCTGAATGTGCAGGACAATGAAGAAATCAC
GGCCCTGTATCACTCTACATTGGCCATTCGCCCCAAGTTGATTGAGCTCATTGGGAAATACTCGCAGAAAAAGGG
TAAGATGATTTCGACATGTCGCTATTCTCCGCTAATGCTTTGCAGACGAGTTCACGCAGCTCAACGAGAAGTTCA
TCAAGGCGCGGAGAGATTACGAGTCTCTGCTGGAGGCGTCCATGGCGCACCCAGCACAATCCCAGTATGGCCGGC
CGGCTCAACCTCCTTACGGCTATCCTGGTGCTGCTCCTGTGGGATATCCTCAAGGGCCGCCACAAGCTGATCCTC
AACGCTACTTCAGTCCCCGTCCTCAAGGTGGGTGCTGCATGGATACATTCTCAGCTCATGTCTAACAAACACATA
GCAGAAACACAAGCCCCTCCGGCCAACGCGCCCGCATTCTACGGCACAGAACAAGCACACGCATATCCTCCCACT
TCACAATCGCCTGATCCCCGTCAGACACCACCTGCTGGCGCTCCGTATCAGCAGCCGCAGCCACAGCAGCAACGT
CAACCCTCCTCGGAGTCCTACCAGCCCGTGTACCACCGTCCGGAATCCACATACGAGAATCCGCAAGAACTCGGC
ACATCGGTCTACGATTCCCCGGTCGAGCATCCTGCCAGCCAGCGACCACCATATCCCGGCGCCGTGCAGGTCCCG
GCCGCCGTGCAGCAGCATTTCCAACAGCAACAGCAGCAGCCGCAACAGCAGTCACAACAACCACACCCGGAATAC
CCGGCCTCAGGCTACACTCCTGAAGACGCCTCCAGACCCCCTGCCCACCAAGCACAGCCTCCTTACCCTTCACAC
CAACCGCCGCCTATGCACCAGCCCCCGCCTGTCCCAGGTACATCCACAACGCCGACACCTTATCCTGCTCTGAAC
GCGGGCGGAGGATACCAGGCATATAACCCGTCTCAAACGGATGTATCTAACCCAGCGTCGTTCTACCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail