Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g2442.t1
Gene name
Locationscaffold_010:129004..130566
Strand-
Gene length (bp)1562
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03849 Tfb2 Transcription factor Tfb2 1.0E-133 11 382
PF18307 Tfb2_C Transcription factor Tfb2 (p52) C-terminal domain 5.0E-23 410 475

GO

GO Term Description Terminal node
GO:0001671 ATPase activator activity Yes
GO:0006289 nucleotide-excision repair Yes
GO:0000439 transcription factor TFIIH core complex Yes
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0006281 DNA repair No
GO:0003674 molecular_function No
GO:0006974 cellular response to DNA damage stimulus No
GO:0140513 nuclear protein-containing complex No
GO:0006950 response to stress No
GO:0032991 protein-containing complex No
GO:0033554 cellular response to stress No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0140677 molecular function activator activity No
GO:0008152 metabolic process No
GO:0098772 molecular function regulator activity No
GO:0005667 transcription regulator complex No
GO:0006259 DNA metabolic process No
GO:0090575 RNA polymerase II transcription regulator complex No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0050896 response to stimulus No
GO:0005575 cellular_component No
GO:0044260 cellular macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g2442.t1
MAAAPSSRPFEYLESLAGTVFYKLYQQPSTALAIFRRMLPDLAKCFVMALLYLKDPLPAADLEAWVKSESLKERD
NALSILGRLHILSNTVTADNVRAYKVTDPFATSLRHALTGADQTQSFGVLSQVPAGSEVSIPELDEYARRQWEGV
LGYMVGTGGMGGPQVTLSKGVKELLQAGHLVEIRDRRVEITQDGFAFVLQDVSTQVWHILILYVESASAIKMDSV
EVLSFVFLLSSLELGKSYEKNHLSSKQLRMLTDLADFGIVYQESPDAPRFYPTRLATTLTSDSSALSNPLLGSLS
GPAGEASSKAGTGFIIIETNYRVYAYTSSPLQISLIALFTTLKYRFPNLITGKITRQSVRRAVEMGITADQIISY
LSTHAHPQMRKHNVSRSTSNQAGIPPSVLPPTVVDQIRLWQLERDRVKATSGFLFKDFVSLAEYEAPCRYAEEIG
VLAWKSDRKRMFFVTRHEQVAAFLRSRK*
Coding >Ani_SJS100_1|g2442.t1
ATGGCTGCCGCACCATCTTCTCGTCCCTTTGAATACCTCGAAAGCCTTGCTGGCACTGTCTTCTACAAACTTTAC
CAGCAGCCATCAACGGCTCTCGCCATTTTCAGGCGCATGCTGCCTGATCTGGCAAAATGCTTTGTCATGGCACTT
CTCTACCTAAAGGATCCGCTCCCCGCGGCGGATCTGGAGGCTTGGGTTAAATCGGAGAGCTTGAAAGAACGCGAC
AATGCACTCTCCATCCTAGGAAGACTGCATATTTTATCCAACACTGTTACGGCGGATAATGTCCGCGCCTACAAA
GTCACCGATCCCTTCGCCACTTCATTGCGACACGCTCTCACCGGCGCCGACCAAACACAATCTTTTGGCGTCCTT
TCACAAGTGCCTGCTGGCTCGGAAGTCTCGATCCCCGAACTTGATGAGTATGCGCGACGACAGTGGGAAGGAGTG
CTGGGATACATGGTCGGTACTGGAGGCATGGGAGGTCCCCAAGTGACCCTCAGCAAAGGCGTGAAGGAGCTCCTG
CAGGCGGGTCATCTGGTCGAGATCCGAGATCGTCGCGTCGAAATCACCCAGGATGGGTTTGCCTTTGTCCTGCAA
GATGTCAGCACGCAGGTGTGGCATATCTTGATTCTTTACGTCGAGAGCGCCAGCGCCATCAAGATGGACAGTGTC
GAAGTCCTCTCGTTCGTGTTCCTTCTCAGCAGTCTCGAACTCGGAAAATCATATGAAAAGAACCACCTCAGTTCG
AAACAACTGCGCATGCTGACCGACCTTGCCGACTTTGGTATCGTCTATCAAGAATCGCCGGATGCACCGCGTTTC
TACCCCACCCGTCTTGCAACCACCCTCACGTCCGACTCCAGCGCCTTGAGCAACCCACTCTTGGGTTCCCTCTCC
GGTCCTGCTGGCGAAGCCTCCAGCAAAGCGGGTACGGGCTTCATCATTATCGAAACCAACTACCGTGTATACGCA
TACACCTCGTCTCCCCTACAGATCTCCCTGATTGCTCTGTTCACCACACTGAAATACCGCTTCCCCAACCTCATC
ACCGGCAAAATCACCCGCCAATCCGTCCGCCGGGCCGTCGAGATGGGCATCACCGCCGACCAAATCATTTCCTAT
CTCTCTACTCACGCCCACCCGCAAATGCGCAAGCACAACGTCTCCCGCTCGACCTCAAACCAGGCCGGGATCCCC
CCGTCAGTCCTCCCGCCAACCGTGGTGGACCAGATTCGACTTTGGCAGCTGGAGCGGGACCGTGTCAAAGCTACG
TCCGGATTTCTTTTCAAGGACTTTGTCAGTCTGGCAGAATACGAGGCGCCATGTCGCTATGCCGAAGAAATCGGT
GTTCTGGCATGGAAGTCGGATCGCAAACGCATGTTCTTCGTGACGAGGCATGAACAAGTGGCTGCGTTCTTAAGG
AGCCGGAAATAA
Transcript >Ani_SJS100_1|g2442.t1
ATGGCTGCCGCACCATCTTCTCGTCCCTTTGAATACCTCGAAAGCCTTGCTGGCACTGTCTTCTACAAACTTTAC
CAGCAGCCATCAACGGCTCTCGCCATTTTCAGGCGCATGCTGCCTGATCTGGCAAAATGCTTTGTCATGGCACTT
CTCTACCTAAAGGATCCGCTCCCCGCGGCGGATCTGGAGGCTTGGGTTAAATCGGAGAGCTTGAAAGAACGCGAC
AATGCACTCTCCATCCTAGGAAGACTGCATATTTTATCCAACACTGTTACGGCGGATAATGTCCGCGCCTACAAA
GTCACCGATCCCTTCGCCACTTCATTGCGACACGCTCTCACCGGCGCCGACCAAACACAATCTTTTGGCGTCCTT
TCACAAGTGCCTGCTGGCTCGGAAGTCTCGATCCCCGAACTTGATGAGTATGCGCGACGACAGTGGGAAGGAGTG
CTGGGATACATGGTCGGTACTGGAGGCATGGGAGGTCCCCAAGTGACCCTCAGCAAAGGCGTGAAGGAGCTCCTG
CAGGCGGGTCATCTGGTCGAGATCCGAGATCGTCGCGTCGAAATCACCCAGGATGGGTTTGCCTTTGTCCTGCAA
GATGTCAGCACGCAGGTGTGGCATATCTTGATTCTTTACGTCGAGAGCGCCAGCGCCATCAAGATGGACAGTGTC
GAAGTCCTCTCGTTCGTGTTCCTTCTCAGCAGTCTCGAACTCGGAAAATCATATGAAAAGAACCACCTCAGTTCG
AAACAACTGCGCATGCTGACCGACCTTGCCGACTTTGGTATCGTCTATCAAGAATCGCCGGATGCACCGCGTTTC
TACCCCACCCGTCTTGCAACCACCCTCACGTCCGACTCCAGCGCCTTGAGCAACCCACTCTTGGGTTCCCTCTCC
GGTCCTGCTGGCGAAGCCTCCAGCAAAGCGGGTACGGGCTTCATCATTATCGAAACCAACTACCGTGTATACGCA
TACACCTCGTCTCCCCTACAGATCTCCCTGATTGCTCTGTTCACCACACTGAAATACCGCTTCCCCAACCTCATC
ACCGGCAAAATCACCCGCCAATCCGTCCGCCGGGCCGTCGAGATGGGCATCACCGCCGACCAAATCATTTCCTAT
CTCTCTACTCACGCCCACCCGCAAATGCGCAAGCACAACGTCTCCCGCTCGACCTCAAACCAGGCCGGGATCCCC
CCGTCAGTCCTCCCGCCAACCGTGGTGGACCAGATTCGACTTTGGCAGCTGGAGCGGGACCGTGTCAAAGCTACG
TCCGGATTTCTTTTCAAGGACTTTGTCAGTCTGGCAGAATACGAGGCGCCATGTCGCTATGCCGAAGAAATCGGT
GTTCTGGCATGGAAGTCGGATCGCAAACGCATGTTCTTCGTGACGAGGCATGAACAAGTGGCTGCGTTCTTAAGG
AGCCGGAAATAA
Gene >Ani_SJS100_1|g2442.t1
ATGGCTGCCGCACCATCTTCTCGTCCCTTTGAATACCTCGAAAGCCTTGCTGGCACTGTCTTCTACAAACTTTAC
CAGCAGCCATCAACGGCTCTCGCCATTTTCAGGCGCATGCTGCCTGATCTGGGTATGTGTCGCATGTGCATTCAC
CACTCCGGTGCTTCATCAACTAACTGCCTGACTAGCAAAATGCTTTGTCATGGCACTTCTCTACCTAAAGGATCC
GCTCCCCGCGGCGGATCTGGAGGCTTGGGTTAAATCGGAGAGCTTGAAGTAAGTGCGGGTCAAGCACCCTGGGAA
GGTTTCCGCAGTGATTGTGGTTAACGTGAGCCTCACACAGAGAACGCGACAATGCACTCTCCATCCTAGGAAGAC
TGCATATTTTATCCAACACTGTTACGGCGGATAATGTCCGCGCCTACAAAGTCACCGATCCCTTCGCCACTTCAT
TGCGACACGCTCTCACCGGCGCCGACCAAACACAATCTTTTGGCGTCCTTTCACAAGTGCCTGCTGGCTCGGAAG
TCTCGATCCCCGAACTTGATGAGTATGCGCGACGACAGTGGGAAGGAGTGCTGGGATACATGGTCGGTACTGGAG
GCATGGGAGGTCCCCAAGTGACCCTCAGCAAAGGCGTGAAGGAGCTCCTGCAGGCGGGTCATCTGGTCGAGATCC
GAGATCGTCGCGTCGAAATCACCCAGGATGGGTTTGCCTTTGTCCTGCAAGATGTCAGCACGCAGGTGTGGCATA
TCTTGATTCTTTACGTCGAGAGCGCCAGCGCCATCAAGATGGACAGTGTCGAAGTCCTCTCGTTCGTGTTCCTTC
TCAGCAGTCTCGAACTCGGAAAATCATATGAAAAGAACCACCTCAGTTCGAAACAACTGCGCATGCTGACCGACC
TTGCCGACTTTGGTATCGTCTATCAAGAATCGCCGGATGCACCGCGTTTCTACCCCACCCGTCTTGCAACCACCC
TCACGTCCGACTCCAGCGCCTTGAGCAACCCACTCTTGGGTTCCCTCTCCGGTCCTGCTGGCGAAGCCTCCAGCA
AAGCGGGTACGGGCTTCATCATTATCGAAACCAACTACCGTGTATACGCATACACCTCGTCTCCCCTACAGATCT
CCCTGATTGCTCTGTTCACCACACTGAAATACCGCTTCCCCAACCTCATCACCGGCAAAATCACCCGCCAATCCG
TCCGCCGGGCCGTCGAGATGGGCATCACCGCCGACCAAATCATTTCCTATCTCTCTACTCACGCCCACCCGCAAA
TGCGCAAGCACAACGTCTCCCGCTCGACCTCAAACCAGGCCGGGATCCCCCCGTCAGTCCTCCCGCCAACCGTGG
TGGACCAGATTCGACTTTGGCAGCTGGAGCGGGACCGTGTCAAAGCTACGTCCGGATTTCTTTTCAAGGACTTTG
TCAGTCTGGCAGAATACGAGGCGCCATGTCGCTATGCCGAAGAAATCGGTGTTCTGGCATGGAAGTCGGATCGCA
AACGCATGTTCTTCGTGACGAGGCATGAACAAGTGGCTGCGTTCTTAAGGAGCCGGAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail