Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g2295.t1
Gene name
Locationscaffold_009:305302..308631
Strand+
Gene length (bp)3329
Transcript length (bp)3051
Coding sequence length (bp)3051
Protein length (aa) 1017

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01301 Glyco_hydro_35 Glycosyl hydrolases family 35 1.7E-80 47 393
PF13364 BetaGal_dom4_5 Beta-galactosidase jelly roll domain 1.1E-26 695 804
PF13364 BetaGal_dom4_5 Beta-galactosidase jelly roll domain 4.6E-37 862 976
PF10435 BetaGal_dom2 Beta-galactosidase, domain 2 1.0E-63 404 584
PF13363 BetaGal_dom3 Beta-galactosidase, domain 3 9.5E-26 585 659
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 1.0E-05 62 246
PF02449 Glyco_hydro_42 Beta-galactosidase 1.5E-04 71 163

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004565 beta-galactosidase activity Yes
GO:0071704 organic substance metabolic process Yes
GO:0009341 beta-galactosidase complex Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003824 catalytic activity No
GO:0015925 galactosidase activity No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0044238 primary metabolic process No
GO:0032991 protein-containing complex No
GO:1902494 catalytic complex No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g2295.t1
MTRITKLCVLLLSSIGLLAAAQNQTETVWPLHDDGLTTDIQWDHYSFKVHGERIFVFSGEFHYWRIPVPGLWRDI
LEKIKAAGFTTFAFYSSWAWHAPNNHTVDFSTGARDITPIFELAKELGMYIIVRPGPYINAEASAGGFPLWLTTG
DYGTLRNNDSRYTEAWKPYFEKMTEITSRYQITNGHNTFCYQIENEYGDQWLSDPSERVPNETAIAYMELLESSA
RENGILVPFTANDPNMNAMAWSRDWSNAGGNVDVVGLDSYPSCWTCDVSQCTSTNGEYVAYQVVEYYDYFLDFSP
TMPSFMPEFQGGSYNPWAGPEGGCGDDTGVDFVNLFYRWNIAQRVTAMSLYMLYGGTNWGAIAAPVTATSYDYSS
PISEDRSISSKYYETKLLSLFTRSARDLTMTDLIGNGTQYTNNTAVKAYELRNPTTNAGFYVTLHEDSTVGTNEA
FNLRVNTSAGNLIVPRLGGSIRLNGHQAKIIVTDFTFGSETLLYSTAEVLTYAVIDKKPTLVLWVPTGESGEFAV
KGAKSGSVVSKCQSCPAINFHQQGGNLIVGFTQSQGMSVVQIDNDIRVVLLDRTAAYKFWAPALTEDPLVPEDEA
VLIQGPYIVRSASLEKSTLAIKGDSINETAVEIFAPENVKTITWNGKQLKTSKSSYGSLKATIAAPASIQLPAFT
SWKVNDSLPERLPTYDASGPAWVDANHMTTANPSKPATLPVLYADEYGFHNGVRLWRGYFNGTASGVFLNVQGGS
AFGFSAYLNGHFLGSYLGNASIEQANQTFLFPNNITHPTTQNTLLVIHDDTGHDETTGALNPRGILEARLLPSDT
TNNSTSPEFTHWRIAGTAGGESNLDPVRGAWNEDGLYAERVGWHLPGFDDSTWSSVTSSSSLSFTGATVKFFRTT
IPLDIPRGLDVSISFVLGTPDNAPNAYRAQLFVNGYQYGRFNPYIGNQVVFPVPVGVLDYTGENTIGVAVWAQTE
DGAGITVDWKVNYVADSSLDVSGLETGGLRPGWSAERLKFA*
Coding >Ani_SJS100_1|g2295.t1
ATGACGCGGATCACCAAGTTATGCGTTCTCCTACTCTCCAGTATAGGTCTTCTGGCCGCTGCCCAAAACCAGACG
GAGACTGTGTGGCCACTTCACGATGATGGCCTGACCACAGACATCCAGTGGGATCATTACAGTTTCAAAGTCCAT
GGTGAGAGGATCTTTGTCTTCTCTGGCGAATTTCATTACTGGCGCATTCCAGTTCCTGGCCTATGGAGGGATATC
CTTGAGAAGATTAAAGCTGCAGGCTTTACGACTTTCGCATTCTACTCGAGCTGGGCGTGGCATGCCCCGAATAAT
CACACAGTTGACTTCTCCACGGGTGCTCGCGACATCACGCCGATTTTCGAACTCGCAAAGGAGCTTGGGATGTAC
ATCATCGTCCGCCCTGGTCCCTACATCAATGCGGAAGCCAGTGCAGGTGGCTTTCCTCTGTGGCTGACGACTGGC
GACTATGGAACGTTGCGCAATAACGATTCGCGGTACACCGAAGCATGGAAGCCATACTTCGAGAAGATGACAGAG
ATTACTAGTCGCTACCAGATTACGAATGGCCATAATACGTTTTGCTACCAGATTGAGAACGAGTATGGCGATCAA
TGGCTCAGTGACCCGAGCGAGAGGGTTCCCAACGAGACAGCCATCGCCTACATGGAGCTTCTTGAAAGCAGCGCT
CGTGAAAACGGTATTCTTGTGCCATTCACGGCAAATGACCCGAATATGAATGCCATGGCTTGGAGTCGCGATTGG
TCCAACGCTGGAGGCAACGTCGATGTCGTGGGCTTGGATTCTTATCCTTCATGCTGGACTTGCGATGTCAGTCAG
TGTACGTCCACCAATGGCGAGTATGTAGCCTACCAGGTTGTCGAATACTATGACTACTTCCTCGATTTCTCGCCA
ACAATGCCGTCGTTCATGCCCGAATTCCAGGGCGGCTCGTACAACCCCTGGGCTGGGCCCGAGGGTGGCTGCGGC
GACGATACTGGAGTGGACTTTGTCAACCTCTTCTACCGGTGGAACATCGCCCAGCGAGTGACCGCCATGAGTCTC
TACATGTTGTATGGAGGAACGAACTGGGGAGCGATTGCTGCGCCTGTCACGGCCACTAGCTACGACTATTCTTCC
CCCATCTCTGAGGACCGCTCCATCTCGTCCAAGTACTACGAAACCAAGCTGCTGTCATTGTTTACACGCAGTGCA
CGAGACCTGACAATGACTGACCTCATCGGTAACGGAACGCAGTACACCAATAACACTGCTGTCAAAGCGTACGAA
CTGCGGAACCCTACAACCAACGCTGGATTTTACGTCACGCTTCATGAGGACTCAACTGTCGGCACTAACGAGGCG
TTCAACCTGCGCGTCAACACATCCGCGGGTAATCTGATCGTCCCCAGGCTTGGAGGCTCAATCCGTCTTAATGGC
CATCAAGCCAAGATTATCGTCACTGATTTCACTTTCGGCTCGGAGACCCTTCTGTACTCTACGGCCGAAGTCCTC
ACTTACGCTGTCATTGACAAGAAGCCCACCCTCGTCCTTTGGGTTCCGACAGGCGAGTCCGGAGAATTCGCAGTG
AAGGGCGCGAAATCCGGGTCTGTTGTATCGAAGTGTCAAAGCTGCCCTGCGATCAACTTCCACCAACAGGGCGGT
AACCTCATCGTCGGATTTACTCAGTCCCAGGGAATGAGTGTTGTCCAGATTGACAACGACATCCGAGTGGTCCTA
CTGGACAGGACTGCGGCTTACAAATTCTGGGCTCCTGCTCTAACAGAGGATCCCCTTGTTCCGGAGGATGAGGCG
GTTCTTATCCAAGGCCCGTATATCGTTCGCTCTGCCAGCCTGGAGAAATCAACACTCGCAATAAAGGGCGACTCC
ATCAATGAAACCGCTGTGGAAATCTTCGCGCCTGAGAATGTCAAGACCATCACATGGAACGGCAAGCAGCTAAAG
ACTTCCAAATCCTCATACGGTAGCCTCAAGGCCACAATTGCTGCGCCTGCATCCATTCAATTGCCAGCGTTCACT
TCGTGGAAAGTCAACGACAGCCTGCCGGAGCGCCTTCCGACATACGATGCCTCCGGTCCCGCGTGGGTTGATGCA
AACCACATGACAACCGCCAACCCCAGCAAGCCTGCCACACTGCCAGTCCTATACGCGGACGAATACGGCTTCCAC
AACGGCGTCCGCCTCTGGCGCGGCTACTTCAACGGCACCGCCAGCGGAGTCTTCCTGAATGTCCAAGGAGGCAGC
GCATTCGGCTTCTCCGCCTACCTAAACGGCCACTTTCTAGGCTCCTACCTTGGCAACGCCTCCATCGAACAAGCC
AACCAAACCTTCCTCTTCCCGAACAACATCACCCACCCAACCACCCAAAACACCCTCCTGGTCATCCACGACGAC
ACCGGCCACGACGAAACCACCGGCGCCCTCAACCCGCGCGGCATCCTCGAAGCGCGCCTCCTTCCCTCCGACACC
ACTAACAACAGCACCTCCCCCGAGTTCACCCACTGGCGCATCGCCGGCACCGCCGGCGGCGAGTCCAACCTCGAC
CCCGTCCGCGGCGCCTGGAACGAAGACGGCCTGTACGCCGAACGAGTCGGATGGCATCTCCCCGGCTTCGACGAT
AGCACATGGTCCAGTGTAACATCGTCTTCGAGTCTATCCTTCACGGGGGCGACGGTCAAGTTCTTCCGGACTACG
ATTCCCTTGGATATCCCGCGTGGCCTGGACGTATCCATCTCATTTGTGTTGGGTACCCCGGACAATGCACCTAAT
GCGTATCGGGCACAGCTGTTCGTCAACGGATACCAGTATGGACGGTTTAATCCGTATATTGGGAACCAGGTGGTG
TTCCCGGTTCCCGTCGGGGTGTTGGATTATACTGGGGAGAATACGATTGGGGTGGCGGTGTGGGCGCAGACGGAG
GATGGGGCGGGGATTACGGTGGATTGGAAGGTGAATTATGTGGCGGATAGTTCGTTGGATGTGAGTGGGTTGGAG
ACCGGGGGGTTGAGGCCGGGGTGGAGTGCGGAGAGGTTGAAGTTTGCTTGA
Transcript >Ani_SJS100_1|g2295.t1
ATGACGCGGATCACCAAGTTATGCGTTCTCCTACTCTCCAGTATAGGTCTTCTGGCCGCTGCCCAAAACCAGACG
GAGACTGTGTGGCCACTTCACGATGATGGCCTGACCACAGACATCCAGTGGGATCATTACAGTTTCAAAGTCCAT
GGTGAGAGGATCTTTGTCTTCTCTGGCGAATTTCATTACTGGCGCATTCCAGTTCCTGGCCTATGGAGGGATATC
CTTGAGAAGATTAAAGCTGCAGGCTTTACGACTTTCGCATTCTACTCGAGCTGGGCGTGGCATGCCCCGAATAAT
CACACAGTTGACTTCTCCACGGGTGCTCGCGACATCACGCCGATTTTCGAACTCGCAAAGGAGCTTGGGATGTAC
ATCATCGTCCGCCCTGGTCCCTACATCAATGCGGAAGCCAGTGCAGGTGGCTTTCCTCTGTGGCTGACGACTGGC
GACTATGGAACGTTGCGCAATAACGATTCGCGGTACACCGAAGCATGGAAGCCATACTTCGAGAAGATGACAGAG
ATTACTAGTCGCTACCAGATTACGAATGGCCATAATACGTTTTGCTACCAGATTGAGAACGAGTATGGCGATCAA
TGGCTCAGTGACCCGAGCGAGAGGGTTCCCAACGAGACAGCCATCGCCTACATGGAGCTTCTTGAAAGCAGCGCT
CGTGAAAACGGTATTCTTGTGCCATTCACGGCAAATGACCCGAATATGAATGCCATGGCTTGGAGTCGCGATTGG
TCCAACGCTGGAGGCAACGTCGATGTCGTGGGCTTGGATTCTTATCCTTCATGCTGGACTTGCGATGTCAGTCAG
TGTACGTCCACCAATGGCGAGTATGTAGCCTACCAGGTTGTCGAATACTATGACTACTTCCTCGATTTCTCGCCA
ACAATGCCGTCGTTCATGCCCGAATTCCAGGGCGGCTCGTACAACCCCTGGGCTGGGCCCGAGGGTGGCTGCGGC
GACGATACTGGAGTGGACTTTGTCAACCTCTTCTACCGGTGGAACATCGCCCAGCGAGTGACCGCCATGAGTCTC
TACATGTTGTATGGAGGAACGAACTGGGGAGCGATTGCTGCGCCTGTCACGGCCACTAGCTACGACTATTCTTCC
CCCATCTCTGAGGACCGCTCCATCTCGTCCAAGTACTACGAAACCAAGCTGCTGTCATTGTTTACACGCAGTGCA
CGAGACCTGACAATGACTGACCTCATCGGTAACGGAACGCAGTACACCAATAACACTGCTGTCAAAGCGTACGAA
CTGCGGAACCCTACAACCAACGCTGGATTTTACGTCACGCTTCATGAGGACTCAACTGTCGGCACTAACGAGGCG
TTCAACCTGCGCGTCAACACATCCGCGGGTAATCTGATCGTCCCCAGGCTTGGAGGCTCAATCCGTCTTAATGGC
CATCAAGCCAAGATTATCGTCACTGATTTCACTTTCGGCTCGGAGACCCTTCTGTACTCTACGGCCGAAGTCCTC
ACTTACGCTGTCATTGACAAGAAGCCCACCCTCGTCCTTTGGGTTCCGACAGGCGAGTCCGGAGAATTCGCAGTG
AAGGGCGCGAAATCCGGGTCTGTTGTATCGAAGTGTCAAAGCTGCCCTGCGATCAACTTCCACCAACAGGGCGGT
AACCTCATCGTCGGATTTACTCAGTCCCAGGGAATGAGTGTTGTCCAGATTGACAACGACATCCGAGTGGTCCTA
CTGGACAGGACTGCGGCTTACAAATTCTGGGCTCCTGCTCTAACAGAGGATCCCCTTGTTCCGGAGGATGAGGCG
GTTCTTATCCAAGGCCCGTATATCGTTCGCTCTGCCAGCCTGGAGAAATCAACACTCGCAATAAAGGGCGACTCC
ATCAATGAAACCGCTGTGGAAATCTTCGCGCCTGAGAATGTCAAGACCATCACATGGAACGGCAAGCAGCTAAAG
ACTTCCAAATCCTCATACGGTAGCCTCAAGGCCACAATTGCTGCGCCTGCATCCATTCAATTGCCAGCGTTCACT
TCGTGGAAAGTCAACGACAGCCTGCCGGAGCGCCTTCCGACATACGATGCCTCCGGTCCCGCGTGGGTTGATGCA
AACCACATGACAACCGCCAACCCCAGCAAGCCTGCCACACTGCCAGTCCTATACGCGGACGAATACGGCTTCCAC
AACGGCGTCCGCCTCTGGCGCGGCTACTTCAACGGCACCGCCAGCGGAGTCTTCCTGAATGTCCAAGGAGGCAGC
GCATTCGGCTTCTCCGCCTACCTAAACGGCCACTTTCTAGGCTCCTACCTTGGCAACGCCTCCATCGAACAAGCC
AACCAAACCTTCCTCTTCCCGAACAACATCACCCACCCAACCACCCAAAACACCCTCCTGGTCATCCACGACGAC
ACCGGCCACGACGAAACCACCGGCGCCCTCAACCCGCGCGGCATCCTCGAAGCGCGCCTCCTTCCCTCCGACACC
ACTAACAACAGCACCTCCCCCGAGTTCACCCACTGGCGCATCGCCGGCACCGCCGGCGGCGAGTCCAACCTCGAC
CCCGTCCGCGGCGCCTGGAACGAAGACGGCCTGTACGCCGAACGAGTCGGATGGCATCTCCCCGGCTTCGACGAT
AGCACATGGTCCAGTGTAACATCGTCTTCGAGTCTATCCTTCACGGGGGCGACGGTCAAGTTCTTCCGGACTACG
ATTCCCTTGGATATCCCGCGTGGCCTGGACGTATCCATCTCATTTGTGTTGGGTACCCCGGACAATGCACCTAAT
GCGTATCGGGCACAGCTGTTCGTCAACGGATACCAGTATGGACGGTTTAATCCGTATATTGGGAACCAGGTGGTG
TTCCCGGTTCCCGTCGGGGTGTTGGATTATACTGGGGAGAATACGATTGGGGTGGCGGTGTGGGCGCAGACGGAG
GATGGGGCGGGGATTACGGTGGATTGGAAGGTGAATTATGTGGCGGATAGTTCGTTGGATGTGAGTGGGTTGGAG
ACCGGGGGGTTGAGGCCGGGGTGGAGTGCGGAGAGGTTGAAGTTTGCTTGA
Gene >Ani_SJS100_1|g2295.t1
ATGACGCGGATCACCAAGTTATGCGTTCTCCTACTCTCCAGTATAGGTCTTCTGGCCGCTGCCCAAAACCAGACG
GAGACTGTGTGGCCACTTCACGATGATGGCCTGACCACAGACATCCAGTGGGATCATTACAGTTTCAAAGTCCAT
GGTGAGAGGATCTTTGTCTTCTCTGGCGAATTTCATTACTGGCGCATTCCAGTTCCTGGCCTATGGAGGGATATC
CTTGAGAAGATTAAAGCTGCAGGCTTTACGACTTTCGCATTCTACTCGAGCTGGGCGTGGCATGCCCCGAATAAT
CACACAGTTGACTTCTCCACGGGTGCTCGCGACATCACGCCGATTTTCGAACTCGCAAAGGAGCTTGGGATGTAC
ATCATCGTCCGCCCTGGTCCCTACATCAATGCGGAAGCCAGTGCAGGTGGCTTTCCTCTGTGGCTGACGACTGGC
GACTATGGAACGTTGCGCAATAACGATTCGCGGTACACCGAAGCATGGAAGCCATACTTCGAGAAGATGACAGAG
ATTACTAGTCGCTACCAGATTACGAATGGCCATAATACGTTTTGCTACCAGATTGAGAACGAGTATGGCGATCAA
TGGCTCAGTGACCCGAGCGAGAGGGTTCCCAACGAGACAGCCATCGCCTACATGGAGCTTCTTGAAAGCAGCGCT
CGTGAAAACGGTATTCTTGTGCCATTCACGGCAAATGACCCGAATATGAATGCCATGGCTTGGAGTCGCGATTGG
TCCAACGCTGGAGGCAACGTCGATGTCGTGGGCTTGGATTCTTATCCTTCAGTAAGTGGCTTGTCGCTATTGATT
GAAAACTCGGCTCAGCTGACTTTCCAAGTGCTGGACTTGCGATGTCAGTCAGTGTACGTCCACCAATGGCGAGTA
TGTAGCCTACCAGGTTGTCGAATACTATGACTACTTCCTCGATTTCTCGCCAACAATGCCGTCGTTCATGCCCGA
ATTCCAGGGCGGCTCGTACAACCCCTGGGCTGGGCCCGAGGGTGGCTGCGGCGACGATACTGGAGTGGACTTTGT
CAACCTCTTCTACCGGTGGAACATCGCCCAGCGAGTGACCGCCATGAGTCTCTACATGTTGTATGGAGGAACGAA
CTGGGGAGCGATTGCTGCGCCTGTCACGGCCACTAGCTACGACTATTCTTCCCCCATCTCTGAGGACCGCTCCAT
CTCGTCCAAGTACTACGAAACCAAGCTGCTGTCATTGTTTACACGCAGTGCACGAGACCTGACAATGACTGACCT
CATCGGTAACGGAACGCAGTACACCAATAACACTGCTGTCAAAGCGTACGAACTGCGGAACCCTACAACCAACGC
TGGATTTTACGTCACGCTTCATGAGGACTCAACTGTCGGCACTAACGAGGCGTTCAACCTGCGCGTCAACACATC
CGCGGGTAATCTGATCGTCCCCAGGCTTGGAGGCTCAATCCGTCTTAATGGCCATCAAGCCAAGATTATCGTCAC
TGATTTCACTTTCGGCTCGGAGACCCTTCTGTACTCTACGGCCGAAGTCCTCACTTACGCTGTCATTGACAAGAA
GCCCACCCTCGTCCTTTGGGTTCCGACAGGCGAGTCCGGAGAATTCGCAGTGAAGGGCGCGAAATCCGGGTCTGT
TGTATCGAAGTGTCAAAGCTGCCCTGCGATCAACTTCCACCAACAGGGCGGTAACCTCATCGTCGGATTTACTCA
GTCCCAGGGAATGAGTGTTGTCCAGATTGACAACGACATCCGAGTGGTCCTACTGGACAGGACTGCGGCTTACAA
ATTCTGGGCTCCTGCTCTAACAGAGGATCCCCTTGTTCCGGAGGATGAGGCGGGTAAGAAATCCCAACAGACTCC
TAATATTTCGAGTAACGAGCTAACCCACGAGTAGTTCTTATCCAAGGCCCGTATATCGTTCGCTCTGCCAGCCTG
GAGAAATCAACACTCGCAATAAAGGGCGACTCCATCAATGAAACCGCTGTGGAAATCTTCGCGCCTGAGAATGTC
AAGACCATCACATGGAACGGCAAGCAGCTAAAGACTTCCAAATCCTCATACGGTAGCCTCAAGGCCACAATTGCT
GCGCCTGCATCCATTCAATTGCCAGCGTTCACTTCGTGGAAAGTCAACGACAGCCTGCCGGAGCGCCTTCCGACA
TACGATGCCTCCGGTCCCGCGTGGGTTGGTCAGTACATCCTTTACTTCAACCCCTTTAACTCAATACTGACTAGT
CCTCCCAGATGCAAACCACATGACAACCGCCAACCCCAGCAAGCCTGCCACACTGCCAGTCCTATACGCGGACGA
ATACGGTAAGCCAATTCTCTCCCATTCCCTTCCTAACAAACAAAGCCAAATACTAACCCGACAGGCTTCCACAAC
GGCGTCCGCCTCTGGCGCGGCTACTTCAACGGCACCGCCAGCGGAGTCTTCCTGAATGTCCAAGGAGGCAGCGCA
TTGTAAGCCCCATTCCCCCCTCCCACCTTTGCACAATCACATCTAACAACAAATCAAGCGGCTTCTCCGCCTACC
TAAACGGCCACTTTCTAGGCTCCTACCTTGGCAACGCCTCCATCGAACAAGCCAACCAAACCTTCCTCTTCCCGA
ACAACATCACCCACCCAACCACCCAAAACACCCTCCTGGTCATCCACGACGACACCGGCCACGACGAAACCACCG
GCGCCCTCAACCCGCGCGGCATCCTCGAAGCGCGCCTCCTTCCCTCCGACACCACTAACAACAGCACCTCCCCCG
AGTTCACCCACTGGCGCATCGCCGGCACCGCCGGCGGCGAGTCCAACCTCGACCCCGTCCGCGGCGCCTGGAACG
AAGACGGCCTGTACGCCGAACGAGTCGGATGGCATCTCCCCGGCTTCGACGATAGCACATGGTCCAGTGTAACAT
CGTCTTCGAGTCTATCCTTCACGGGGGCGACGGTCAAGTTCTTCCGGACTACGATTCCCTTGGATATCCCGCGTG
GCCTGGACGTATCCATCTCATTTGTGTTGGGTACCCCGGACAATGCACCTAATGCGTATCGGGCACAGCTGTTCG
TCAACGGATACCAGTATGGACGGTTTAATCCGTATATTGGGAACCAGGTGGTGTTCCCGGTTCCCGTCGGGGTGT
TGGATTATACTGGGGAGAATACGATTGGGGTGGCGGTGTGGGCGCAGACGGAGGATGGGGCGGGGATTACGGTGG
ATTGGAAGGTGAATTATGTGGCGGATAGTTCGTTGGATGTGAGTGGGTTGGAGACCGGGGGGTTGAGGCCGGGGT
GGAGTGCGGAGAGGTTGAAGTTTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail