Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g2294.t1
Gene name
Locationscaffold_009:302111..303808
Strand+
Gene length (bp)1697
Transcript length (bp)1632
Coding sequence length (bp)1632
Protein length (aa) 544

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01151 ELO GNS1/SUR4 family 2.8E-90 59 414

GO

GO Term Description Terminal node
GO:0009922 fatty acid elongase activity Yes
GO:0016021 integral component of membrane Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0016746 acyltransferase activity No
GO:0005575 cellular_component No
GO:0004312 fatty acid synthase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 61 83 22
2 104 126 22
3 247 269 22
4 290 312 22
5 383 405 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g2294.t1
MYDFTVHGEANPAVIRVGLPPSSLLKFPPSELPATVPAPVISEPTWNQPFNIPPKLYNQLLDVRVPITIASVYAV
TVVLVNRLNKSRGYKPYGFSQTRLFKLFVILHNVFLAIYSAWTFAGMIRAFRSSWPSRDDPNYVAAVADTLCKIN
GPRGYGNAATYDTTVDQWTFRNPEFSLAAGGVPDPSDLGRLWNEGLAFLGWIFYLSKFYEVLDTVIILAKGKKSS
TLQTYHHAGAMMCMWAGIRYVAAPIWIFTLVNSGIHALMYTYYTVTALRIRVPTVIKRSLTTMQITQFVIGSAMA
ASYLFFSYTLPVGQTAPASPVDTPTVPAGTAGAGLVPWLKKLGFRAAGAEGIAENVGVPEAAAGVRVLHVGPMVT
CMDTSGQGFAIWLNVMYLLPLTYLFARFFVRSYLYRKEPGPRQPTQLHAAEKAGMDALRGVSREIRKAVEVNGET
SEATEDEAVNKIQALRATKNQQKPAENSPIRTRATAAKQKSRVAGSDADSDSGFSTVSSKKGAKKATKEELQSST
IVVDPKASNPYEVLDRSA*
Coding >Ani_SJS100_1|g2294.t1
ATGTACGACTTCACCGTCCACGGCGAGGCGAACCCAGCCGTCATTCGCGTCGGCCTGCCTCCTTCGTCCCTCTTG
AAGTTCCCTCCCAGCGAGCTCCCGGCAACCGTCCCCGCTCCTGTGATCTCCGAGCCGACATGGAACCAGCCCTTC
AACATCCCGCCGAAGCTCTACAACCAGCTGTTGGACGTGCGCGTTCCGATTACAATCGCGAGTGTGTACGCTGTG
ACGGTGGTCCTCGTCAATCGCCTTAACAAGAGTCGGGGCTACAAGCCTTACGGATTCAGCCAGACGCGTCTCTTC
AAGCTTTTCGTCATCCTCCACAACGTTTTCCTGGCTATTTACTCGGCATGGACTTTTGCGGGCATGATCCGTGCG
TTCCGCAGCTCATGGCCCAGTCGGGATGATCCCAACTACGTCGCAGCTGTTGCCGATACGCTGTGCAAGATCAAT
GGACCCCGGGGTTACGGTAACGCGGCTACGTACGACACTACCGTTGACCAGTGGACCTTCCGCAACCCCGAGTTC
AGTCTGGCTGCAGGAGGTGTTCCGGACCCCTCCGATCTTGGTCGTCTCTGGAATGAGGGTCTGGCCTTCCTCGGC
TGGATCTTCTACCTGTCCAAGTTCTACGAGGTCCTTGACACCGTCATCATTCTGGCCAAGGGTAAGAAGAGCTCG
ACCCTGCAGACGTACCATCACGCCGGTGCCATGATGTGCATGTGGGCAGGTATCCGTTACGTCGCAGCTCCTATC
TGGATCTTCACCTTGGTCAATTCTGGAATTCATGCTTTGATGTACACCTACTACACTGTGACTGCTCTGCGCATC
CGCGTCCCCACCGTGATCAAGAGGTCCTTGACCACCATGCAGATTACCCAGTTTGTCATTGGCTCTGCCATGGCT
GCCTCCTACCTGTTTTTCAGCTACACTCTTCCTGTGGGCCAGACCGCTCCGGCCTCTCCTGTTGACACCCCGACT
GTGCCGGCGGGTACTGCCGGTGCTGGACTTGTGCCATGGCTCAAGAAGCTCGGGTTCCGCGCTGCGGGCGCGGAA
GGTATTGCTGAGAACGTGGGCGTCCCGGAGGCTGCTGCTGGTGTGCGCGTCCTTCATGTCGGACCGATGGTTACC
TGCATGGACACCAGCGGCCAGGGTTTCGCCATCTGGCTCAACGTGATGTACCTTTTGCCTTTGACCTACCTCTTT
GCCCGGTTCTTCGTTCGTTCGTACCTCTACCGTAAGGAGCCCGGTCCCCGGCAGCCGACTCAGCTGCACGCCGCT
GAGAAAGCCGGAATGGATGCTCTGCGAGGCGTGAGCCGCGAGATTCGCAAGGCCGTTGAGGTGAACGGAGAGACC
AGTGAAGCTACCGAAGATGAGGCTGTGAACAAGATCCAGGCCCTCCGGGCAACGAAGAACCAGCAGAAGCCTGCC
GAGAACTCTCCTATTCGCACCCGCGCAACTGCTGCCAAGCAGAAATCGCGTGTCGCGGGCAGCGATGCCGACTCC
GACTCGGGTTTCTCGACCGTCAGCAGCAAGAAGGGTGCCAAGAAGGCGACTAAGGAAGAACTGCAGAGCTCTACC
ATTGTCGTGGACCCCAAAGCCTCTAACCCGTACGAGGTTCTGGATCGCTCGGCATAA
Transcript >Ani_SJS100_1|g2294.t1
ATGTACGACTTCACCGTCCACGGCGAGGCGAACCCAGCCGTCATTCGCGTCGGCCTGCCTCCTTCGTCCCTCTTG
AAGTTCCCTCCCAGCGAGCTCCCGGCAACCGTCCCCGCTCCTGTGATCTCCGAGCCGACATGGAACCAGCCCTTC
AACATCCCGCCGAAGCTCTACAACCAGCTGTTGGACGTGCGCGTTCCGATTACAATCGCGAGTGTGTACGCTGTG
ACGGTGGTCCTCGTCAATCGCCTTAACAAGAGTCGGGGCTACAAGCCTTACGGATTCAGCCAGACGCGTCTCTTC
AAGCTTTTCGTCATCCTCCACAACGTTTTCCTGGCTATTTACTCGGCATGGACTTTTGCGGGCATGATCCGTGCG
TTCCGCAGCTCATGGCCCAGTCGGGATGATCCCAACTACGTCGCAGCTGTTGCCGATACGCTGTGCAAGATCAAT
GGACCCCGGGGTTACGGTAACGCGGCTACGTACGACACTACCGTTGACCAGTGGACCTTCCGCAACCCCGAGTTC
AGTCTGGCTGCAGGAGGTGTTCCGGACCCCTCCGATCTTGGTCGTCTCTGGAATGAGGGTCTGGCCTTCCTCGGC
TGGATCTTCTACCTGTCCAAGTTCTACGAGGTCCTTGACACCGTCATCATTCTGGCCAAGGGTAAGAAGAGCTCG
ACCCTGCAGACGTACCATCACGCCGGTGCCATGATGTGCATGTGGGCAGGTATCCGTTACGTCGCAGCTCCTATC
TGGATCTTCACCTTGGTCAATTCTGGAATTCATGCTTTGATGTACACCTACTACACTGTGACTGCTCTGCGCATC
CGCGTCCCCACCGTGATCAAGAGGTCCTTGACCACCATGCAGATTACCCAGTTTGTCATTGGCTCTGCCATGGCT
GCCTCCTACCTGTTTTTCAGCTACACTCTTCCTGTGGGCCAGACCGCTCCGGCCTCTCCTGTTGACACCCCGACT
GTGCCGGCGGGTACTGCCGGTGCTGGACTTGTGCCATGGCTCAAGAAGCTCGGGTTCCGCGCTGCGGGCGCGGAA
GGTATTGCTGAGAACGTGGGCGTCCCGGAGGCTGCTGCTGGTGTGCGCGTCCTTCATGTCGGACCGATGGTTACC
TGCATGGACACCAGCGGCCAGGGTTTCGCCATCTGGCTCAACGTGATGTACCTTTTGCCTTTGACCTACCTCTTT
GCCCGGTTCTTCGTTCGTTCGTACCTCTACCGTAAGGAGCCCGGTCCCCGGCAGCCGACTCAGCTGCACGCCGCT
GAGAAAGCCGGAATGGATGCTCTGCGAGGCGTGAGCCGCGAGATTCGCAAGGCCGTTGAGGTGAACGGAGAGACC
AGTGAAGCTACCGAAGATGAGGCTGTGAACAAGATCCAGGCCCTCCGGGCAACGAAGAACCAGCAGAAGCCTGCC
GAGAACTCTCCTATTCGCACCCGCGCAACTGCTGCCAAGCAGAAATCGCGTGTCGCGGGCAGCGATGCCGACTCC
GACTCGGGTTTCTCGACCGTCAGCAGCAAGAAGGGTGCCAAGAAGGCGACTAAGGAAGAACTGCAGAGCTCTACC
ATTGTCGTGGACCCCAAAGCCTCTAACCCGTACGAGGTTCTGGATCGCTCGGCATAA
Gene >Ani_SJS100_1|g2294.t1
ATGTACGACTTCACCGTCCACGGCGAGGCGAACCCAGCCGTCATTCGCGTCGGCCTGCCTCCTTCGTCCCTCTTG
AAGTTCCCTCCCAGCGAGCTCCCGGCAACCGTCCCCGCTCCTGTGATCTCCGAGCCGACATGGAACCAGCCCTTC
AACATCCCGCCGAAGCTCTACAACCAGCTGTTGGACGTGCGCGTTCCGATTACAATCGCGAGTGTGTACGCTGTG
ACGGTGGTCCTCGTCAATCGCCTTAACAAGAGTCGGGGCTACAAGCCTTACGGATTCAGCCAGACGCGTCTCTTC
AAGCTTTTCGTCATCCTCCACAACGTTTTCCTGGCTATTTACTCGGCATGGACTTTTGCGGGCATGATCCGTGCG
TTCCGCAGCTCATGGCCCAGTCGGGATGATCCCAACTACGTCGCAGCTGTTGCCGATACGCTGTGCAAGATCAAT
GGACCCCGGGGTTACGGTAACGCGGCTACGTACGACACTACCGTTGACCAGTGGACCTTCCGCAACCCCGAGTTC
AGTCTGGCTGCAGGAGGTGTTCCGGACCCCTCCGATCTTGGTCGTCTCTGGAATGAGGGTCTGGCCTTCCTCGGC
TGGATCTTCTACCTGTCCAAGTTCTACGAGGTCCTTGACACCGTCATCATTCTGGCCAAGGGTAAGAAGAGCTCG
ACCCTGCAGACGTACCATCACGCCGGTGCCATGATGTGCATGTGGGCAGGTATCCGTTACGTCGCAGCTCCTATC
TGGATCTTCACCTTGGTCAATTCTGGAATTCATGCTTTGATGGTATGTGAAGCACGCCCCGTATTGTGTTTCGTC
TGTTGCTCATATGTTCTGACCGTCAAATGCAGTACACCTACTACACTGTGACTGCTCTGCGCATCCGCGTCCCCA
CCGTGATCAAGAGGTCCTTGACCACCATGCAGATTACCCAGTTTGTCATTGGCTCTGCCATGGCTGCCTCCTACC
TGTTTTTCAGCTACACTCTTCCTGTGGGCCAGACCGCTCCGGCCTCTCCTGTTGACACCCCGACTGTGCCGGCGG
GTACTGCCGGTGCTGGACTTGTGCCATGGCTCAAGAAGCTCGGGTTCCGCGCTGCGGGCGCGGAAGGTATTGCTG
AGAACGTGGGCGTCCCGGAGGCTGCTGCTGGTGTGCGCGTCCTTCATGTCGGACCGATGGTTACCTGCATGGACA
CCAGCGGCCAGGGTTTCGCCATCTGGCTCAACGTGATGTACCTTTTGCCTTTGACCTACCTCTTTGCCCGGTTCT
TCGTTCGTTCGTACCTCTACCGTAAGGAGCCCGGTCCCCGGCAGCCGACTCAGCTGCACGCCGCTGAGAAAGCCG
GAATGGATGCTCTGCGAGGCGTGAGCCGCGAGATTCGCAAGGCCGTTGAGGTGAACGGAGAGACCAGTGAAGCTA
CCGAAGATGAGGCTGTGAACAAGATCCAGGCCCTCCGGGCAACGAAGAACCAGCAGAAGCCTGCCGAGAACTCTC
CTATTCGCACCCGCGCAACTGCTGCCAAGCAGAAATCGCGTGTCGCGGGCAGCGATGCCGACTCCGACTCGGGTT
TCTCGACCGTCAGCAGCAAGAAGGGTGCCAAGAAGGCGACTAAGGAAGAACTGCAGAGCTCTACCATTGTCGTGG
ACCCCAAAGCCTCTAACCCGTACGAGGTTCTGGATCGCTCGGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail