Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g2010.t1
Gene name
Locationscaffold_008:55984..57922
Strand-
Gene length (bp)1938
Transcript length (bp)1713
Coding sequence length (bp)1713
Protein length (aa) 571

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.2E-43 64 466
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 1.0E-19 62 455

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.5

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 95 117 22
3 124 143 19
4 153 175 22
5 182 204 22
6 214 233 19
7 253 275 22
8 279 301 22
9 321 343 22
10 358 377 19
11 384 406 22
12 416 438 22
13 451 473 22
14 527 549 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g2010.t1
MAAPAPNEARIATKSEDEDDADSPAQAHDDQHGTSTEAGPDAPETEANPNAMHGFKLFAIFVGICFGAFLMSLDI
FVIATAIPSITSDFHDTAQLAWYPAAYSLTTCALTPLAGKLSSSFPLRWIYISFFSIFMVGSFVCGFAPNSNAFI
VGRAIAGIGASGVASGGFVIVLTVSPEKSKPLLLGICSSCFAMGLILAPVIGGAFTQDTTWRWCFWVNLPPGALT
LLSMLFLFKPPSIQRNKTVAQRILDLDLIGCAIFVPAVFMLLLAMMWGGTKEAWNSATTIGLFVGSGVAFIIFVL
WEGYKGENAMVPGNVVARRTVTFCVLFSFCHFGSVGILNYYLPEWFQVVEGASPLQSGTRVLASVLSQIVGTLFA
GFLARKVHYYNPWLHIGPLFMCTAAALYTHFSAFHTPSSHWIGFQVIQGLGVGMAQQMPSLIVQHTVRDKPELMP
VAISLNLFFQYLGATIMQALGGIVFRSVLYPELADHAGLNSEQIALLSAGGMADVRNTVEEYFPDLLHSVLEAYN
TAITSTFYVAVGTTATAFFLAFGAKWERITDKRTTDPEGAETEHK*
Coding >Ani_SJS100_1|g2010.t1
ATGGCTGCACCTGCTCCAAACGAAGCCAGAATAGCCACCAAGTCAGAGGATGAGGACGATGCCGACAGTCCTGCT
CAGGCTCATGATGATCAGCATGGTACTAGCACAGAGGCTGGGCCTGACGCCCCAGAAACGGAGGCGAATCCAAAC
GCCATGCACGGTTTCAAGCTTTTTGCCATTTTTGTGGGCATATGCTTTGGCGCGTTCCTCATGTCCTTGGATATT
TTCGTCATCGCAACCGCCATCCCATCTATCACGTCCGACTTCCACGATACCGCACAATTGGCCTGGTATCCGGCT
GCCTACTCGCTCACGACGTGCGCATTGACTCCGTTAGCAGGAAAGCTAAGCTCATCATTTCCCCTCCGCTGGATC
TACATATCGTTCTTCTCTATATTTATGGTCGGCAGTTTTGTTTGTGGTTTCGCTCCCAACAGCAACGCTTTCATT
GTCGGTCGCGCAATTGCAGGTATCGGAGCATCAGGTGTCGCAAGTGGCGGCTTCGTTATTGTGCTCACCGTTTCT
CCCGAGAAATCGAAACCATTGTTGTTAGGCATATGCAGCAGCTGCTTCGCTATGGGCCTAATTCTAGCCCCTGTC
ATTGGCGGCGCTTTCACACAGGATACTACCTGGCGGTGGTGTTTCTGGGTGAACCTTCCCCCCGGGGCGCTGACG
CTGCTCTCTATGCTCTTTTTGTTCAAACCTCCATCAATACAGCGCAATAAAACCGTTGCACAGCGAATATTAGAC
CTGGACCTCATTGGGTGTGCCATTTTTGTTCCGGCAGTCTTCATGCTGCTTCTTGCTATGATGTGGGGTGGTACG
AAGGAGGCTTGGAACTCAGCGACAACAATCGGACTATTCGTGGGGTCCGGTGTGGCATTTATCATCTTCGTTTTA
TGGGAAGGCTATAAGGGCGAGAATGCAATGGTACCGGGAAATGTGGTCGCCAGACGAACAGTCACATTCTGTGTC
CTGTTTTCCTTCTGCCACTTCGGCTCTGTCGGTATCCTGAACTACTATCTCCCAGAGTGGTTTCAGGTCGTAGAA
GGGGCCTCTCCATTGCAGAGTGGTACGCGGGTTTTAGCCTCTGTGCTCTCCCAAATAGTTGGCACACTCTTTGCT
GGGTTTCTAGCACGGAAAGTCCACTACTACAATCCATGGCTCCATATCGGACCTCTCTTCATGTGCACCGCCGCA
GCCCTGTACACTCATTTCTCAGCATTCCACACCCCCTCCAGCCATTGGATCGGGTTCCAAGTCATCCAGGGTCTT
GGCGTCGGCATGGCTCAACAAATGCCATCACTCATTGTTCAGCACACTGTGCGTGACAAGCCAGAACTCATGCCG
GTCGCGATATCCCTGAATCTATTCTTTCAATACCTAGGCGCCACTATCATGCAGGCTCTTGGCGGTATTGTGTTT
CGTTCTGTCCTATATCCCGAATTGGCAGATCATGCTGGCTTGAATTCCGAGCAGATTGCGTTGCTGTCTGCGGGT
GGGATGGCAGATGTGCGTAATACCGTGGAGGAGTACTTTCCGGATCTTCTGCACTCGGTTCTGGAGGCGTATAAT
ACCGCTATTACTTCGACTTTTTACGTTGCTGTTGGTACTACAGCTACGGCCTTCTTCCTGGCTTTTGGAGCTAAG
TGGGAGAGGATTACCGACAAACGGACGACTGATCCGGAGGGGGCCGAGACAGAACATAAGTAG
Transcript >Ani_SJS100_1|g2010.t1
ATGGCTGCACCTGCTCCAAACGAAGCCAGAATAGCCACCAAGTCAGAGGATGAGGACGATGCCGACAGTCCTGCT
CAGGCTCATGATGATCAGCATGGTACTAGCACAGAGGCTGGGCCTGACGCCCCAGAAACGGAGGCGAATCCAAAC
GCCATGCACGGTTTCAAGCTTTTTGCCATTTTTGTGGGCATATGCTTTGGCGCGTTCCTCATGTCCTTGGATATT
TTCGTCATCGCAACCGCCATCCCATCTATCACGTCCGACTTCCACGATACCGCACAATTGGCCTGGTATCCGGCT
GCCTACTCGCTCACGACGTGCGCATTGACTCCGTTAGCAGGAAAGCTAAGCTCATCATTTCCCCTCCGCTGGATC
TACATATCGTTCTTCTCTATATTTATGGTCGGCAGTTTTGTTTGTGGTTTCGCTCCCAACAGCAACGCTTTCATT
GTCGGTCGCGCAATTGCAGGTATCGGAGCATCAGGTGTCGCAAGTGGCGGCTTCGTTATTGTGCTCACCGTTTCT
CCCGAGAAATCGAAACCATTGTTGTTAGGCATATGCAGCAGCTGCTTCGCTATGGGCCTAATTCTAGCCCCTGTC
ATTGGCGGCGCTTTCACACAGGATACTACCTGGCGGTGGTGTTTCTGGGTGAACCTTCCCCCCGGGGCGCTGACG
CTGCTCTCTATGCTCTTTTTGTTCAAACCTCCATCAATACAGCGCAATAAAACCGTTGCACAGCGAATATTAGAC
CTGGACCTCATTGGGTGTGCCATTTTTGTTCCGGCAGTCTTCATGCTGCTTCTTGCTATGATGTGGGGTGGTACG
AAGGAGGCTTGGAACTCAGCGACAACAATCGGACTATTCGTGGGGTCCGGTGTGGCATTTATCATCTTCGTTTTA
TGGGAAGGCTATAAGGGCGAGAATGCAATGGTACCGGGAAATGTGGTCGCCAGACGAACAGTCACATTCTGTGTC
CTGTTTTCCTTCTGCCACTTCGGCTCTGTCGGTATCCTGAACTACTATCTCCCAGAGTGGTTTCAGGTCGTAGAA
GGGGCCTCTCCATTGCAGAGTGGTACGCGGGTTTTAGCCTCTGTGCTCTCCCAAATAGTTGGCACACTCTTTGCT
GGGTTTCTAGCACGGAAAGTCCACTACTACAATCCATGGCTCCATATCGGACCTCTCTTCATGTGCACCGCCGCA
GCCCTGTACACTCATTTCTCAGCATTCCACACCCCCTCCAGCCATTGGATCGGGTTCCAAGTCATCCAGGGTCTT
GGCGTCGGCATGGCTCAACAAATGCCATCACTCATTGTTCAGCACACTGTGCGTGACAAGCCAGAACTCATGCCG
GTCGCGATATCCCTGAATCTATTCTTTCAATACCTAGGCGCCACTATCATGCAGGCTCTTGGCGGTATTGTGTTT
CGTTCTGTCCTATATCCCGAATTGGCAGATCATGCTGGCTTGAATTCCGAGCAGATTGCGTTGCTGTCTGCGGGT
GGGATGGCAGATGTGCGTAATACCGTGGAGGAGTACTTTCCGGATCTTCTGCACTCGGTTCTGGAGGCGTATAAT
ACCGCTATTACTTCGACTTTTTACGTTGCTGTTGGTACTACAGCTACGGCCTTCTTCCTGGCTTTTGGAGCTAAG
TGGGAGAGGATTACCGACAAACGGACGACTGATCCGGAGGGGGCCGAGACAGAACATAAGTAG
Gene >Ani_SJS100_1|g2010.t1
ATGGCTGCACCTGCTCCAAACGAAGCCAGAATAGCCACCAAGTCAGAGGATGAGGACGATGCCGACAGTCCTGCT
CAGGCTCATGATGATCAGCATGGTACTAGCACAGAGGCTGGGCCTGACGCCCCAGAAACGGAGGCGAATCCAAAC
GCCATGCACGGTTTCAAGCTTTTTGCCATTTTTGTGGGCATATGCTTTGGCGCGTTCCTCATGTCCTTGGATATT
TTCGTCATCGCAACCGTATTACTACCAGTCCCTCGTGCTATTCCGATAAGATCCAACTGAAAATTATCTGACCCC
CCGGATAGGCCATCCCATCTATCACGTCCGACTTCCACGATACCGCACAATTGGCCTGGTATCCGGCTGCCTACT
CGCTCACGACGTGCGCATTGACTCCGTTAGCAGGAAAGCTAAGCTCATCATTTCCCCTCCGCTGGATCTACATAT
CGTTCTTCTCTATATTTATGGTCGGCAGTTTTGTTTGTGGTTTCGCTCCCAACAGCAACGCTTTCATTGTCGGTC
GCGCAATTGCAGGTATCGGAGCATCAGGTGTCGCAAGTGGCGGCTTCGTTATTGTGCTCACCGTTTCTCCCGAGA
AATCGAAACCATTGTTGTTAGGCATATGCAGCAGCTGCTTCGCTATGGGCCTAATTCTAGCCCCTGTCATTGGCG
GCGCTTTCACACAGGATACTACCTGGCGGTGGTGTTTCTGGGTGAACCTTCCCCCCGGGGCGCTGACGCTGCTCT
CTATGCTCTTTTTGTTCAAACCTCCATCAATACAGCGCAATAAAACCGTTGCACAGCGAATATTAGACCTGGACC
TCATTGGGTGTGCCATTTTTGTTCCGGCAGTCTTCATGCTGCTTCTTGCTATGATGTGGGGTGGTACGAAGGAGG
CTTGGAACTCAGCGACAACAATCGGACTATTCGTGGGGTCCGGTGTGGCATTTATCATCTTCGTTTTATGGGAAG
GCTATAAGGGCGAGAATGCAATGGTACCGGGAAATGTGGTCGCCAGACGAACAGTCACATTCTGTGTCCTGTTTT
CCTTCTGCCACTTCGGCTCTGTCGGTATCCTGAACTACTATCTCCCAGAGTGGTTTCAGGTCGTAGAAGGGGCCT
CTCCATTGCAGAGTGGTACGCGGGTTTTAGCCTCTGTGCTCTCCCAAATAGTTGGCACACTCTTTGCTGGGTTTC
TAGGTATGCTTCTATACATATACTCACTCAGCCACGTCTTAGTTCTTGAAATATCCATGGATACAGAGATGCTGA
CATTGAGGAATTCGTACAGCACGGAAAGTCCACTACTACAATCCATGGCTCCATATCGGACCTCTCTTCATGTGC
ACCGCCGCAGCCCTGTACACTCATTTCTCAGCATTCCACACCCCCTCCAGCCATTGGATCGGGTTCCAAGTCATC
CAGGGTCTTGGCGTCGGCATGGCTCAACAAATGCCATCACTCATTGTTCAGCACACTGTGCGTGACAAGCCAGAA
CTCATGCCGGTCGCGATATCCCTGAATCTATTCTTTCAATACCTAGGCGCCACTATCATGCAGGCTCTTGGCGGT
ATTGTGTTTCGTTCTGTCCTATATCCCGAATTGGCAGATCATGCTGGCTTGAATTCCGAGCAGATTGCGTTGCTG
TCTGCGGGTGGGATGGCAGATGTGCGTAATACCGTGGAGGAGTACTTTCCGGATCTTCTGCACTCGGTTCTGGAG
GCGTATAATACCGCTATTACTTCGACTTTTGTAAGTAGGCCTTCTTCTTCCGCGCTATTGTAGTGTGAGTGAGAC
TAACAGACATGAGCACAATAGTACGTTGCTGTTGGTACTACAGCTACGGCCTTCTTCCTGGCTTTTGGAGCTAAG
TGGGAGAGGATTACCGACAAACGGACGACTGATCCGGAGGGGGCCGAGACAGAACATAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail