Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g1883.t1
Gene name
Locationscaffold_007:309467..312473
Strand-
Gene length (bp)3006
Transcript length (bp)2562
Coding sequence length (bp)2562
Protein length (aa) 854

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain 1.6E-21 76 224
PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase 5.7E-05 336 454

GO

GO Term Description Terminal node
GO:0008194 UDP-glycosyltransferase activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030259 lipid glycosylation Yes
GO:0016758 hexosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0070085 glycosylation No
GO:0044237 cellular metabolic process No
GO:0016757 glycosyltransferase activity No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0030258 lipid modification No
GO:0008152 metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g1883.t1
MELHDPPPPYEEPAVNPWEAQDTHVKDDGRVVVDVNSRLCKTISRLFPHVPEANDQPPPPPPGYWEDIKPKHRLN
IVIQIVGSRGDVQPFIALGTALQQCGHRVRIATHGVFQNFVQESGLEFYPIGGDPSQLMAYMVKNPGLIPRMSSL
REGEISKKQHMMAEVLHGCWHSCIASDPTTQVPFVADAIIANPPSFAHVHCAQALGIPVHLMFTMPWSATRAFPH
PLANLKNAAANQDWVNNVSYGVVDWLSWQGLGDVINQWRKQDLDLEPISMSEGPFLLRTLKVPYTYCWSPALVPK
PSDWPANFGILVLFPYCAYVCGFFFRDPPDFKPDQALETFLNAGPPPIYIGFGSIVLDDPEKMTRTLVEAIEQTG
VRALISRGWSKLGGIESDNIMYLDDCPHEWLFQRVSAVIHHGGAGTTACGLRYGKPTFIVPFFGDQPFWGQMVAA
NGAGPDPVPHQLLDAQKLTHGIQFCLSTDAMQAAHRIATRMQHESGVQTAVASFHKNLPKDLKTCEIIPGFPASW
VIRKQKKKIYLSKVAVEILLDHLRISKDKLQPYQPRPIHIENERWDPITGISSAGMGWTVDMLKASGDIVYKPYK
VLKQKDAPDTSHTARQSTSSTTPRSSISAENTQLLQSPSAQQHIHKSQSMTDMALTPEAPETEKKNKAAAMASAS
AKASGKLLTKYVSGAIVDIPLAAAEGFRVLPGLYGDKVHDYGQVKDWKSGTVAGAKSFALGIGEGMTDIFYQPYK
GARDNGAKGFATGFLKGTFGAVGKVAHGSLGLVAYPGQGVKRTIQHALRNKRRKQVVDALHADGQSMLRQERDRG
LRDAVVLDLFDRLTQKEEDLSDDEDDYL*
Coding >Ani_SJS100_1|g1883.t1
ATGGAACTTCATGACCCGCCCCCGCCCTACGAGGAACCAGCAGTGAACCCATGGGAAGCACAAGACACCCACGTC
AAAGATGACGGACGCGTTGTGGTAGACGTCAATTCTCGACTATGCAAAACCATCTCCCGACTCTTCCCGCATGTA
CCGGAAGCGAATGATCAACCACCACCCCCACCTCCCGGGTACTGGGAAGATATCAAGCCCAAACATCGCCTAAAC
ATCGTTATTCAGATTGTCGGCAGCCGGGGAGACGTGCAACCATTCATCGCTCTAGGAACAGCCTTGCAGCAATGC
GGCCACCGCGTGCGGATCGCCACGCATGGGGTGTTCCAAAACTTCGTGCAGGAGTCCGGACTGGAGTTCTACCCC
ATCGGCGGCGACCCCAGCCAGCTGATGGCTTACATGGTGAAGAACCCTGGTTTGATCCCGCGGATGAGCAGTCTC
CGTGAAGGTGAAATCTCGAAGAAGCAGCACATGATGGCGGAGGTTCTGCACGGCTGCTGGCACTCATGTATTGCA
AGCGACCCGACTACTCAGGTTCCATTCGTTGCTGATGCTATTATCGCTAATCCACCCAGCTTTGCCCACGTTCAC
TGTGCGCAAGCTCTGGGGATCCCGGTGCACTTGATGTTTACGATGCCTTGGAGTGCTACGCGCGCCTTCCCGCAC
CCGTTGGCAAACTTGAAGAACGCAGCGGCGAATCAAGATTGGGTTAATAATGTTTCTTATGGTGTTGTAGATTGG
CTGTCGTGGCAGGGGCTAGGAGACGTCATTAACCAATGGCGTAAACAGGACTTGGACTTGGAGCCTATCTCAATG
TCAGAAGGGCCTTTCCTTCTACGAACTCTGAAGGTGCCGTATACGTACTGTTGGTCTCCAGCGCTGGTACCGAAA
CCAAGTGACTGGCCTGCCAATTTTGGTATTCTCGTTCTATTCCCTTACTGTGCCTATGTTTGTGGTTTTTTCTTC
CGCGATCCGCCCGACTTCAAGCCTGATCAAGCGCTCGAAACCTTTCTCAATGCCGGGCCACCCCCGATTTATATC
GGCTTCGGGAGCATTGTCCTTGATGACCCGGAAAAGATGACACGCACACTCGTTGAGGCTATCGAGCAAACGGGA
GTTCGAGCATTGATTTCTCGAGGCTGGAGCAAGCTTGGTGGCATTGAGAGTGATAATATCATGTACCTGGACGAT
TGCCCCCATGAATGGCTGTTCCAGCGTGTAAGTGCCGTGATCCACCATGGCGGAGCCGGGACCACGGCCTGCGGG
CTGCGCTATGGCAAGCCCACGTTTATTGTACCTTTCTTTGGCGACCAACCCTTTTGGGGCCAGATGGTAGCTGCC
AACGGCGCAGGCCCCGACCCAGTACCACACCAACTACTTGACGCACAGAAACTCACCCATGGTATCCAATTTTGC
CTAAGCACTGATGCCATGCAAGCCGCGCATCGCATTGCGACTAGGATGCAACATGAATCGGGAGTGCAGACTGCT
GTTGCATCGTTCCATAAGAATCTTCCCAAGGATCTGAAGACCTGTGAAATAATCCCTGGGTTTCCAGCATCATGG
GTTATAAGGAAACAGAAGAAGAAAATTTACCTGTCTAAAGTCGCGGTAGAGATTTTGTTGGATCATCTGAGAATT
TCCAAAGATAAGCTACAACCATACCAACCCCGACCAATCCACATTGAGAACGAAAGATGGGACCCTATTACTGGG
ATCTCGTCAGCCGGAATGGGGTGGACGGTAGATATGCTCAAGGCATCAGGAGACATCGTCTACAAGCCGTACAAG
GTACTAAAGCAGAAGGACGCACCGGATACTAGCCACACCGCACGACAATCGACATCCTCCACGACCCCTCGCTCA
AGCATAAGCGCCGAAAATACACAACTCCTACAGTCCCCATCTGCACAGCAACACATACATAAATCCCAATCTATG
ACCGACATGGCACTAACGCCGGAAGCTCCCGAAACCGAGAAGAAAAACAAAGCAGCTGCCATGGCCTCAGCATCT
GCGAAAGCCTCTGGCAAGCTTCTAACGAAGTACGTGTCCGGCGCAATCGTCGATATCCCACTAGCTGCTGCGGAG
GGGTTTCGCGTTCTACCCGGTCTGTATGGAGACAAGGTTCACGATTACGGCCAAGTTAAGGACTGGAAATCTGGA
ACAGTGGCTGGAGCAAAGTCCTTTGCTTTGGGGATTGGCGAGGGCATGACGGATATTTTTTACCAACCGTACAAG
GGCGCGAGAGATAACGGAGCGAAGGGGTTTGCGACGGGGTTTCTGAAGGGGACATTCGGCGCGGTTGGTAAGGTA
GCTCATGGCTCTTTGGGTCTCGTTGCTTATCCTGGGCAGGGGGTAAAACGGACTATACAGCATGCGCTGCGTAAT
AAGCGTCGGAAGCAGGTGGTCGATGCTCTGCATGCCGATGGTCAGAGCATGCTTCGACAAGAGAGAGACCGGGGG
CTTCGGGATGCGGTAGTCCTGGATCTGTTCGACCGACTGACGCAGAAGGAAGAAGATCTGAGTGATGATGAAGAT
GACTATCTGTGA
Transcript >Ani_SJS100_1|g1883.t1
ATGGAACTTCATGACCCGCCCCCGCCCTACGAGGAACCAGCAGTGAACCCATGGGAAGCACAAGACACCCACGTC
AAAGATGACGGACGCGTTGTGGTAGACGTCAATTCTCGACTATGCAAAACCATCTCCCGACTCTTCCCGCATGTA
CCGGAAGCGAATGATCAACCACCACCCCCACCTCCCGGGTACTGGGAAGATATCAAGCCCAAACATCGCCTAAAC
ATCGTTATTCAGATTGTCGGCAGCCGGGGAGACGTGCAACCATTCATCGCTCTAGGAACAGCCTTGCAGCAATGC
GGCCACCGCGTGCGGATCGCCACGCATGGGGTGTTCCAAAACTTCGTGCAGGAGTCCGGACTGGAGTTCTACCCC
ATCGGCGGCGACCCCAGCCAGCTGATGGCTTACATGGTGAAGAACCCTGGTTTGATCCCGCGGATGAGCAGTCTC
CGTGAAGGTGAAATCTCGAAGAAGCAGCACATGATGGCGGAGGTTCTGCACGGCTGCTGGCACTCATGTATTGCA
AGCGACCCGACTACTCAGGTTCCATTCGTTGCTGATGCTATTATCGCTAATCCACCCAGCTTTGCCCACGTTCAC
TGTGCGCAAGCTCTGGGGATCCCGGTGCACTTGATGTTTACGATGCCTTGGAGTGCTACGCGCGCCTTCCCGCAC
CCGTTGGCAAACTTGAAGAACGCAGCGGCGAATCAAGATTGGGTTAATAATGTTTCTTATGGTGTTGTAGATTGG
CTGTCGTGGCAGGGGCTAGGAGACGTCATTAACCAATGGCGTAAACAGGACTTGGACTTGGAGCCTATCTCAATG
TCAGAAGGGCCTTTCCTTCTACGAACTCTGAAGGTGCCGTATACGTACTGTTGGTCTCCAGCGCTGGTACCGAAA
CCAAGTGACTGGCCTGCCAATTTTGGTATTCTCGTTCTATTCCCTTACTGTGCCTATGTTTGTGGTTTTTTCTTC
CGCGATCCGCCCGACTTCAAGCCTGATCAAGCGCTCGAAACCTTTCTCAATGCCGGGCCACCCCCGATTTATATC
GGCTTCGGGAGCATTGTCCTTGATGACCCGGAAAAGATGACACGCACACTCGTTGAGGCTATCGAGCAAACGGGA
GTTCGAGCATTGATTTCTCGAGGCTGGAGCAAGCTTGGTGGCATTGAGAGTGATAATATCATGTACCTGGACGAT
TGCCCCCATGAATGGCTGTTCCAGCGTGTAAGTGCCGTGATCCACCATGGCGGAGCCGGGACCACGGCCTGCGGG
CTGCGCTATGGCAAGCCCACGTTTATTGTACCTTTCTTTGGCGACCAACCCTTTTGGGGCCAGATGGTAGCTGCC
AACGGCGCAGGCCCCGACCCAGTACCACACCAACTACTTGACGCACAGAAACTCACCCATGGTATCCAATTTTGC
CTAAGCACTGATGCCATGCAAGCCGCGCATCGCATTGCGACTAGGATGCAACATGAATCGGGAGTGCAGACTGCT
GTTGCATCGTTCCATAAGAATCTTCCCAAGGATCTGAAGACCTGTGAAATAATCCCTGGGTTTCCAGCATCATGG
GTTATAAGGAAACAGAAGAAGAAAATTTACCTGTCTAAAGTCGCGGTAGAGATTTTGTTGGATCATCTGAGAATT
TCCAAAGATAAGCTACAACCATACCAACCCCGACCAATCCACATTGAGAACGAAAGATGGGACCCTATTACTGGG
ATCTCGTCAGCCGGAATGGGGTGGACGGTAGATATGCTCAAGGCATCAGGAGACATCGTCTACAAGCCGTACAAG
GTACTAAAGCAGAAGGACGCACCGGATACTAGCCACACCGCACGACAATCGACATCCTCCACGACCCCTCGCTCA
AGCATAAGCGCCGAAAATACACAACTCCTACAGTCCCCATCTGCACAGCAACACATACATAAATCCCAATCTATG
ACCGACATGGCACTAACGCCGGAAGCTCCCGAAACCGAGAAGAAAAACAAAGCAGCTGCCATGGCCTCAGCATCT
GCGAAAGCCTCTGGCAAGCTTCTAACGAAGTACGTGTCCGGCGCAATCGTCGATATCCCACTAGCTGCTGCGGAG
GGGTTTCGCGTTCTACCCGGTCTGTATGGAGACAAGGTTCACGATTACGGCCAAGTTAAGGACTGGAAATCTGGA
ACAGTGGCTGGAGCAAAGTCCTTTGCTTTGGGGATTGGCGAGGGCATGACGGATATTTTTTACCAACCGTACAAG
GGCGCGAGAGATAACGGAGCGAAGGGGTTTGCGACGGGGTTTCTGAAGGGGACATTCGGCGCGGTTGGTAAGGTA
GCTCATGGCTCTTTGGGTCTCGTTGCTTATCCTGGGCAGGGGGTAAAACGGACTATACAGCATGCGCTGCGTAAT
AAGCGTCGGAAGCAGGTGGTCGATGCTCTGCATGCCGATGGTCAGAGCATGCTTCGACAAGAGAGAGACCGGGGG
CTTCGGGATGCGGTAGTCCTGGATCTGTTCGACCGACTGACGCAGAAGGAAGAAGATCTGAGTGATGATGAAGAT
GACTATCTGTGA
Gene >Ani_SJS100_1|g1883.t1
ATGGAACTTCATGACCCGCCCCCGCCCTACGAGGAACCAGCAGTGAACCCATGGGAAGCACAAGACACCCACGTC
AAAGGTATGTGCGATACGCGGAGCCCCTTCCTTACCCCATCCTCTGGCTCCGCAGAATGTCCCTTACGAGTCTTT
ACATCAACTCACGCCGACTAACATCTTGTAGATGACGGACGCGTTGTGGTAGACGTCAATTCTCGACTATGCAAA
ACCATCTCCCGACTCTTCCCGCATGTACCGGAAGCGAATGATCAACCACCACCCCCACCTCCCGGGTACTGGGAA
GATATCAAGCCCAAACATCGCCTAAACATCGTTATTCAGATTGTCGGCAGCCGGGGAGACGTGCAACCATTCATC
GCTCTAGGAACAGCCTTGCAGCAATGCGGCCACCGCGTGCGGATCGCCACGCATGGGGTGTTCCAAAACTTCGTG
CAGGAGTCCGGACTGGAGTTCTACCCCATCGGCGGCGACCCCAGCCAGCTGATGGCTTACATGGTGAAGAACCCT
GGTTTGATCCCGCGGATGAGCAGTCTCCGTGAAGGTGAAATCTCGAAGAAGCAGCACATGATGGCGGAGGTTCTG
CACGGCTGCTGGCACTCATGTATTGCAAGCGACCCGACTACTCAGGTTCCATTCGTTGCTGATGCTATTATCGCT
AATCCACCCAGCTTTGCCCACGTTCACTGTGCGCAAGCTCTGGGGATCCCGGTGCACTTGATGTTTACGATGCCT
TGGAGTGCTACGCGCGCCTTCCCGCACCCGTTGGCAAACTTGAAGAACGCAGCGGCGAATCAAGATTGGGTTAAT
AATGTTTCTTATGGTGTTGTAGATTGGCTGTCGTGGCAGGGGTAAGGCTGTCTCGCTGGTTCTTTACCATTCTTC
TGCAGATCAGCTCAACTAACTGTTGTTCTCTGATACTTCCAGGCTAGGAGACGTCATTAACCAATGGCGTAAACA
GGACTTGGACTTGGAGCCTATCTCAATGTCAGAAGGGCCTTTCCTTCTACGAACTCTGAAGGTGCCGTATACGTA
CTGTTGGTCTCCAGCGCTGGTACCGAAACCAAGTGACTGGCCTGCCAATTTTGGTATTCTCGTTCTATTCCCTTA
CTGTGCCTGTACGCGTCTGGATCCAATACTAATAAGAGGCTTGCTTGAGATTAGATGTTTGTGGTTTTTTCTTCC
GCGATCCGCCCGACTTCAAGCCTGATCAAGCGCTCGAAACCTTTCTCAATGCCGGGCCACCCCCGATTTATATCG
GCTTCGGGAGCATTGTCCTTGATGACCCGGAAAAGATGACACGCACACTCGTTGAGGCTATCGAGCAAACGGGAG
TTCGAGCATTGATTTCTCGAGGCTGGAGCAAGCTTGGTGGCATTGAGAGTGATAATATCATGTACCTGGACGATT
GCCCCCATGAATGGCTGTTCCAGCGTGTAAGTGCCGTGATCCACCATGGCGGAGCCGGGACCACGGCCTGCGGGC
TGCGCTATGGCAAGCCCACGTTTATTGTACCTTTCTTTGGCGAGTAAGTCCAATTGAGACCCACTGGTTGCCCTT
TGTCTAAATTCGAAGATTCAGCTGACATGGCATTCTTCCTTTGCTCACTAGCCAACCCTTTTGGGGCCAGATGGT
AGCTGCCAACGGCGCAGGCCCCGACCCAGTACCACACCAACTACTTGACGCACAGAAACTCACCCATGGTATCCA
ATTTTGCCTAAGCACTGATGCCATGCAAGCCGCGCATCGCATTGCGACTAGGATGCAACATGAATCGGGAGTGCA
GACTGCTGTTGCATCGTTCCATAAGAATCTTCCCAAGGATCTGAAGACCTGTGAAATAATCCCTGGGTTTCCAGC
ATCATGGGTTATAAGGAAACAGAAGAAGAAAATTTACCTGTCTAAAGTCGCGGTAGAGATTTTGTTGGATCATCT
GAGAATTTCCAAAGATAAGCTACAACCGTCAGATCTTCGTTCCCCCGACGTGGTTTCTCAGTGTTGGCTAACCCT
CGGCATAGATACCAACCCCGACCAATCCACATTGAGAACGAAAGATGGGACCCTATTACTGGGATCTCGTCAGCC
GGAATGGGGTGGACGGTAGATATGCTCAAGGCATCAGGAGACATCGTCTACAAGCCGTACAAGGTACTAAAGCAG
AAGGACGCACCGGATACTAGCCACACCGCACGACAATCGACATCCTCCACGACCCCTCGCTCAAGCATAAGCGCC
GAAAATACACAACTCCTACAGTCCCCATCTGCACAGCAACACATACATAAATCCCAATCTATGACCGACATGGCA
CTAACGCCGGAAGCTCCCGAAACCGAGAAGAAAAACAAAGCAGCTGCCATGGCCTCAGCATCTGCGAAAGCCTCT
GGCAAGCTTCTAACGAAGTACGTGTCCGGCGCAATCGTCGATATCCCACTAGCTGCTGCGGAGGGGTTTCGCGTT
CTACCCGGTCTGTATGGAGACAAGGTTCACGATTACGGCCAAGTTAAGGACTGGAAATCTGGAACAGTGGCTGGA
GCAAAGTCCTTTGCTTTGGGGATTGGCGAGGGCATGACGGATATTTTTTACCAACCGTACAAGGGCGCGAGAGAT
AACGGAGCGAAGGGGTTTGCGACGGGGTTTCTGAAGGGGACATTCGGCGCGGTTGGTAAGGTAGCTCATGGTATG
TGAGATCTTGCATCCATTGAACCTGAAATACGGGGTAGGGAAACTGTGTGATTGCTTGCTAACACATGGGGCGTA
GGCTCTTTGGGTCTCGTTGCTTATCCTGGGCAGGGGGTAAAACGGACTATACAGCATGCGCTGCGTAATAAGCGT
CGGAAGCAGGTGGTCGATGCTCTGCATGCCGATGGTCAGAGCATGCTTCGACAAGAGAGAGACCGGGGGCTTCGG
GATGCGGTAGTCCTGGATCTGTTCGACCGACTGACGCAGAAGGAAGAAGATCTGAGTGATGATGAAGATGACTAT
CTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail