Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g1876.t1
Gene name
Locationscaffold_007:294864..295923
Strand+
Gene length (bp)1059
Transcript length (bp)993
Coding sequence length (bp)993
Protein length (aa) 331

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 3.3E-19 7 306
PF00890 FAD_binding_2 FAD binding domain 4.9E-06 7 44

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g1876.t1
MPADPVDVLIIGGGPAGLTAALTLARQLHTAVLFDNQSYRNSNSPFMHMIPTWDHKDPAQFREQARQEILSNYST
IRLENTSIEKAEKGDDGLFRVTDANGHSWQGRKLILATGSQDIFPPIPGYADAWGKRIFHCLFCKGYEDRSAKRA
GVLAIQSAANVPMAMHQAENAAQLAEQVTIYVNGQEALESQLAATLATQGSNTVFKVDNREITGLALNGDDLSTP
VSIQVQLADGSQVEEAFLVHNPNTQVKSTFATQLGLDLAPSFVPGTGDIAAAAPFHQTSIRGVFAAGDCITPYKV
VAGAISSGCNAAVAASAQLLAEKHGHQPLF*
Coding >Ani_SJS100_1|g1876.t1
ATGCCTGCTGACCCTGTTGACGTGCTCATTATTGGCGGCGGCCCCGCTGGGTTGACAGCTGCTCTCACTCTTGCG
CGTCAACTGCACACAGCTGTCCTCTTCGATAACCAGTCCTACCGCAACAGCAATTCCCCCTTCATGCACATGATC
CCAACATGGGACCACAAAGATCCTGCTCAATTCCGTGAGCAGGCTCGTCAGGAGATCCTATCAAATTACTCCACT
ATTCGCTTGGAGAACACAAGCATCGAAAAGGCAGAAAAAGGAGATGACGGGCTTTTCAGAGTAACCGACGCGAAT
GGGCATTCTTGGCAAGGAAGAAAATTGATCCTTGCCACTGGATCCCAGGACATTTTTCCACCCATCCCCGGCTAC
GCTGATGCCTGGGGAAAGCGCATCTTCCACTGCCTCTTCTGTAAAGGCTACGAGGACCGCAGCGCAAAACGGGCA
GGCGTTCTCGCCATACAGTCCGCCGCAAATGTGCCGATGGCAATGCATCAAGCGGAAAATGCTGCCCAGCTGGCC
GAACAGGTTACCATCTATGTCAATGGACAAGAGGCCCTTGAGTCCCAATTGGCTGCCACATTGGCCACTCAGGGC
AGCAACACTGTGTTCAAGGTTGATAATCGTGAGATAACAGGTCTGGCACTCAACGGGGATGATCTGAGTACTCCG
GTCTCCATTCAGGTCCAGCTTGCCGATGGTAGCCAGGTCGAAGAGGCTTTTCTCGTGCATAATCCTAACACGCAG
GTCAAGAGTACGTTCGCTACTCAGTTGGGGCTGGACCTGGCACCCAGCTTTGTCCCTGGTACGGGCGATATAGCT
GCTGCAGCGCCTTTCCATCAGACCAGCATTCGGGGCGTGTTTGCTGCAGGTGACTGTATCACTCCGTATAAGGTG
GTTGCGGGTGCCATTTCTAGTGGATGCAATGCGGCTGTTGCGGCTTCAGCACAATTGCTGGCAGAAAAGCATGGT
CACCAGCCACTCTTTTGA
Transcript >Ani_SJS100_1|g1876.t1
ATGCCTGCTGACCCTGTTGACGTGCTCATTATTGGCGGCGGCCCCGCTGGGTTGACAGCTGCTCTCACTCTTGCG
CGTCAACTGCACACAGCTGTCCTCTTCGATAACCAGTCCTACCGCAACAGCAATTCCCCCTTCATGCACATGATC
CCAACATGGGACCACAAAGATCCTGCTCAATTCCGTGAGCAGGCTCGTCAGGAGATCCTATCAAATTACTCCACT
ATTCGCTTGGAGAACACAAGCATCGAAAAGGCAGAAAAAGGAGATGACGGGCTTTTCAGAGTAACCGACGCGAAT
GGGCATTCTTGGCAAGGAAGAAAATTGATCCTTGCCACTGGATCCCAGGACATTTTTCCACCCATCCCCGGCTAC
GCTGATGCCTGGGGAAAGCGCATCTTCCACTGCCTCTTCTGTAAAGGCTACGAGGACCGCAGCGCAAAACGGGCA
GGCGTTCTCGCCATACAGTCCGCCGCAAATGTGCCGATGGCAATGCATCAAGCGGAAAATGCTGCCCAGCTGGCC
GAACAGGTTACCATCTATGTCAATGGACAAGAGGCCCTTGAGTCCCAATTGGCTGCCACATTGGCCACTCAGGGC
AGCAACACTGTGTTCAAGGTTGATAATCGTGAGATAACAGGTCTGGCACTCAACGGGGATGATCTGAGTACTCCG
GTCTCCATTCAGGTCCAGCTTGCCGATGGTAGCCAGGTCGAAGAGGCTTTTCTCGTGCATAATCCTAACACGCAG
GTCAAGAGTACGTTCGCTACTCAGTTGGGGCTGGACCTGGCACCCAGCTTTGTCCCTGGTACGGGCGATATAGCT
GCTGCAGCGCCTTTCCATCAGACCAGCATTCGGGGCGTGTTTGCTGCAGGTGACTGTATCACTCCGTATAAGGTG
GTTGCGGGTGCCATTTCTAGTGGATGCAATGCGGCTGTTGCGGCTTCAGCACAATTGCTGGCAGAAAAGCATGGT
CACCAGCCACTCTTTTGA
Gene >Ani_SJS100_1|g1876.t1
ATGCCTGCTGACCCTGTTGACGTGCTCATTATTGGCGGCGGCCCCGCTGGGTTGACAGCTGCTCTCACTCTTGCG
CGTCAACTGCACACAGCTGTCCTCTTCGATAACCAGTCCTACCGCAACAGCAATTCCCCCTTCATGCACATGATC
CCAACATGGGACCACAAAGATCCTGCTCAATTCCGTGAGCAGGCTCGTCAGGAGATCCTATCAAATTACTCCACT
ATTCGCTTGGAGAACACAAGCATCGAAAAGGCAGAAAAAGGAGATGACGGGCTTTTCAGAGTAACCGACGCGAAT
GGGCATTCTTGGCAAGGAAGAAAATTGATCCTTGCCACTGGATCCCAGGACATTTTTCCACCCATCCCCGGCTAC
GCTGATGCCTGGGGAAAGCGCATGTAAGCTCGCCAGCACTCACCGTTCCCTCTCATTGCTCCAAAGCTTCAACTG
ACTCTTCCGTGTAGCTTCCACTGCCTCTTCTGTAAAGGCTACGAGGACCGCAGCGCAAAACGGGCAGGCGTTCTC
GCCATACAGTCCGCCGCAAATGTGCCGATGGCAATGCATCAAGCGGAAAATGCTGCCCAGCTGGCCGAACAGGTT
ACCATCTATGTCAATGGACAAGAGGCCCTTGAGTCCCAATTGGCTGCCACATTGGCCACTCAGGGCAGCAACACT
GTGTTCAAGGTTGATAATCGTGAGATAACAGGTCTGGCACTCAACGGGGATGATCTGAGTACTCCGGTCTCCATT
CAGGTCCAGCTTGCCGATGGTAGCCAGGTCGAAGAGGCTTTTCTCGTGCATAATCCTAACACGCAGGTCAAGAGT
ACGTTCGCTACTCAGTTGGGGCTGGACCTGGCACCCAGCTTTGTCCCTGGTACGGGCGATATAGCTGCTGCAGCG
CCTTTCCATCAGACCAGCATTCGGGGCGTGTTTGCTGCAGGTGACTGTATCACTCCGTATAAGGTGGTTGCGGGT
GCCATTTCTAGTGGATGCAATGCGGCTGTTGCGGCTTCAGCACAATTGCTGGCAGAAAAGCATGGTCACCAGCCA
CTCTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail