Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g1772.t1
Gene name
Locationscaffold_006:639610..642203
Strand+
Gene length (bp)2593
Transcript length (bp)2394
Coding sequence length (bp)2394
Protein length (aa) 798

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01846 FF FF domain 6.4E-16 162 211
PF01846 FF FF domain 7.5E-13 229 279
PF01846 FF FF domain 5.2E-05 298 351
PF01846 FF FF domain 2.9E-13 377 430
PF00397 WW WW domain 1.2E-08 11 39
PF00397 WW WW domain 2.4E-07 54 80

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g1772.t1
MNPMNGPAGAPSMWQEARNSDGRVYYYNVQTKATQWAKPIELMTPVERALANQPWKEYTAEGGRKYWYNTETKQS
TWEMPDVYKTALAQAPAPQAPPVAGPTFVAGGVSSFSSYPQQRDRDDYDRGYGDRRGGYGSMDTNGIAAAPVLGT
QQAEPEYGSLEEAESAFMKMLKRHNVQPDWSWEQTMRETIKDPQYRALKDPRDRKAAFEKYAVEVRMQEKDRAKE
RFAKLRADFNTMLKRHPEIKHYSRWKTIRPIIEGETIFRSTDDENERRQLFEEYIVELKKEHIEEEAVKRKAAMD
ELVTILKSLNLEPYTRWSEAQAIIQSNDKVQSDDKFRTLSKSDILTAFENHIKSLERAFNDARQQQKAAKARKER
HAREQFIELLKELRSQGKIKAGSKWMNIYPLIHEDPRYVGILGNSGSSPLDLFWDMVEEEERSLRGPRNDVLDVL
DDKRFEVTPKTTLEEFNAAVSGDRRTANIDPEILELIFQRIQEKAVRRSEEEKHAADRHQRRAIDSLRSRIKRLD
PPVRATDTWEQVRPRIERFDEYKSLETDELRQAAFDKVIRRLKEKEEDAERDRETRDRDRGSRRDHHDRDRDHRS
GPSYRGERRGTSSRLSRTPEPDAYEADRRKAQADRERSYRKASGLSPVRERREERDRDRERYRERERDRDRDRDW
DRDRSARPLSHYERERREREEERERLYRTRGDPRGGRDELDYGADTKSTTSNDRRRRRDSDTESVASRSAKRYRR
DSRERERSRGARRDRDRRERTPAATDDGKKEEKAVHSGSEEGEIEED*
Coding >Ani_SJS100_1|g1772.t1
ATGAATCCCATGAACGGTCCGGCTGGCGCGCCCTCCATGTGGCAGGAGGCGCGTAACTCTGACGGTCGAGTTTAC
TACTACAATGTACAGACGAAGGCGACGCAATGGGCGAAGCCCATCGAGCTGATGACGCCTGTAGAGCGTGCCTTG
GCAAACCAGCCGTGGAAGGAATATACTGCTGAGGGTGGTCGGAAATACTGGTACAACACCGAAACCAAGCAAAGC
ACGTGGGAGATGCCAGATGTTTACAAAACTGCTCTGGCACAGGCTCCAGCGCCTCAGGCTCCTCCAGTGGCGGGT
CCGACTTTCGTTGCAGGTGGTGTTAGCTCCTTTTCTTCCTACCCACAACAGCGTGACCGCGACGACTATGATCGA
GGCTATGGCGACCGACGTGGAGGATATGGTTCGATGGATACCAATGGCATCGCCGCGGCCCCTGTCCTAGGTACA
CAGCAAGCCGAACCGGAATACGGCTCTCTCGAAGAGGCAGAGAGCGCATTCATGAAAATGCTGAAGCGCCACAAC
GTGCAACCCGACTGGAGCTGGGAACAGACCATGCGTGAAACCATCAAGGATCCCCAGTATCGTGCCCTCAAAGAC
CCCAGAGACCGCAAGGCAGCATTTGAAAAATATGCGGTCGAGGTTCGCATGCAGGAAAAGGATCGGGCGAAAGAA
AGATTCGCTAAGCTCAGAGCAGATTTTAATACCATGCTGAAGCGCCATCCTGAGATTAAACATTACAGTCGCTGG
AAGACCATCCGACCGATCATCGAGGGCGAAACGATCTTTAGATCTACAGATGATGAAAACGAGAGGCGCCAGCTC
TTCGAGGAATACATTGTTGAGCTCAAGAAGGAGCACATCGAGGAGGAAGCTGTTAAGCGCAAAGCTGCTATGGAT
GAGCTGGTGACTATCTTGAAGTCCCTGAACCTGGAACCATACACACGCTGGTCTGAAGCACAGGCGATTATTCAG
TCAAATGACAAAGTCCAAAGCGATGATAAATTCAGAACCCTGAGCAAGTCCGATATTTTGACTGCATTCGAGAAC
CACATCAAGTCCCTTGAGCGGGCCTTCAATGATGCGCGTCAGCAACAAAAGGCTGCAAAGGCGAGAAAAGAGCGT
CATGCCCGCGAGCAGTTTATCGAGCTTCTGAAAGAGCTGAGATCTCAGGGTAAGATTAAGGCCGGAAGCAAGTGG
ATGAACATCTACCCCTTGATCCACGAGGATCCTCGGTACGTTGGTATCCTGGGTAACTCCGGATCTTCTCCCCTG
GATCTATTTTGGGATATGGTTGAAGAAGAAGAACGCTCGTTGCGTGGCCCGCGTAACGATGTCTTGGATGTACTT
GATGACAAACGCTTCGAGGTTACACCAAAGACCACTCTTGAAGAGTTCAACGCTGCTGTATCCGGTGATCGCCGC
ACGGCCAATATTGATCCCGAGATACTTGAACTGATTTTCCAGCGTATCCAGGAGAAGGCTGTCCGACGAAGCGAG
GAAGAGAAGCACGCTGCAGACCGTCATCAGCGCCGTGCTATCGATTCATTGCGTTCCCGGATCAAACGCCTCGAT
CCCCCTGTCCGTGCAACTGATACTTGGGAACAGGTGCGGCCAAGAATCGAAAGATTCGATGAGTACAAGTCTCTG
GAGACCGATGAGCTCCGACAGGCCGCCTTTGACAAGGTTATTCGCCGCCTGAAGGAGAAGGAGGAGGACGCGGAA
CGAGACCGCGAGACCCGCGACAGGGATCGCGGAAGTCGCCGTGATCACCACGACCGTGATCGTGATCATCGCAGC
GGGCCATCCTATAGAGGCGAAAGAAGGGGAACATCTAGCCGTCTTAGCCGAACCCCAGAACCAGATGCCTACGAG
GCAGATCGCCGTAAAGCCCAAGCAGACCGTGAACGCTCCTACCGGAAGGCCAGCGGTCTATCACCCGTCCGAGAG
CGACGGGAAGAGCGTGATCGAGACAGGGAACGTTACCGTGAGCGTGAGCGGGATAGGGACCGCGATCGCGACTGG
GACCGTGATCGCAGCGCACGTCCTCTTAGCCACTACGAACGCGAGCGTCGCGAGCGCGAGGAAGAGCGCGAACGC
CTCTATCGCACACGCGGTGATCCCCGCGGAGGTCGGGATGAGCTGGATTATGGTGCCGATACCAAGAGCACCACA
AGCAATGATCGTAGGCGCAGACGCGACAGCGACACCGAAAGTGTTGCCAGTCGCTCTGCAAAGCGGTACCGACGT
GATAGTCGGGAGCGCGAACGCAGCCGGGGTGCCAGGCGAGATCGAGACCGTCGCGAGCGGACTCCAGCGGCGACC
GATGATGGAAAGAAAGAGGAAAAGGCCGTCCACTCCGGTAGTGAAGAAGGGGAGATTGAAGAAGATTAA
Transcript >Ani_SJS100_1|g1772.t1
ATGAATCCCATGAACGGTCCGGCTGGCGCGCCCTCCATGTGGCAGGAGGCGCGTAACTCTGACGGTCGAGTTTAC
TACTACAATGTACAGACGAAGGCGACGCAATGGGCGAAGCCCATCGAGCTGATGACGCCTGTAGAGCGTGCCTTG
GCAAACCAGCCGTGGAAGGAATATACTGCTGAGGGTGGTCGGAAATACTGGTACAACACCGAAACCAAGCAAAGC
ACGTGGGAGATGCCAGATGTTTACAAAACTGCTCTGGCACAGGCTCCAGCGCCTCAGGCTCCTCCAGTGGCGGGT
CCGACTTTCGTTGCAGGTGGTGTTAGCTCCTTTTCTTCCTACCCACAACAGCGTGACCGCGACGACTATGATCGA
GGCTATGGCGACCGACGTGGAGGATATGGTTCGATGGATACCAATGGCATCGCCGCGGCCCCTGTCCTAGGTACA
CAGCAAGCCGAACCGGAATACGGCTCTCTCGAAGAGGCAGAGAGCGCATTCATGAAAATGCTGAAGCGCCACAAC
GTGCAACCCGACTGGAGCTGGGAACAGACCATGCGTGAAACCATCAAGGATCCCCAGTATCGTGCCCTCAAAGAC
CCCAGAGACCGCAAGGCAGCATTTGAAAAATATGCGGTCGAGGTTCGCATGCAGGAAAAGGATCGGGCGAAAGAA
AGATTCGCTAAGCTCAGAGCAGATTTTAATACCATGCTGAAGCGCCATCCTGAGATTAAACATTACAGTCGCTGG
AAGACCATCCGACCGATCATCGAGGGCGAAACGATCTTTAGATCTACAGATGATGAAAACGAGAGGCGCCAGCTC
TTCGAGGAATACATTGTTGAGCTCAAGAAGGAGCACATCGAGGAGGAAGCTGTTAAGCGCAAAGCTGCTATGGAT
GAGCTGGTGACTATCTTGAAGTCCCTGAACCTGGAACCATACACACGCTGGTCTGAAGCACAGGCGATTATTCAG
TCAAATGACAAAGTCCAAAGCGATGATAAATTCAGAACCCTGAGCAAGTCCGATATTTTGACTGCATTCGAGAAC
CACATCAAGTCCCTTGAGCGGGCCTTCAATGATGCGCGTCAGCAACAAAAGGCTGCAAAGGCGAGAAAAGAGCGT
CATGCCCGCGAGCAGTTTATCGAGCTTCTGAAAGAGCTGAGATCTCAGGGTAAGATTAAGGCCGGAAGCAAGTGG
ATGAACATCTACCCCTTGATCCACGAGGATCCTCGGTACGTTGGTATCCTGGGTAACTCCGGATCTTCTCCCCTG
GATCTATTTTGGGATATGGTTGAAGAAGAAGAACGCTCGTTGCGTGGCCCGCGTAACGATGTCTTGGATGTACTT
GATGACAAACGCTTCGAGGTTACACCAAAGACCACTCTTGAAGAGTTCAACGCTGCTGTATCCGGTGATCGCCGC
ACGGCCAATATTGATCCCGAGATACTTGAACTGATTTTCCAGCGTATCCAGGAGAAGGCTGTCCGACGAAGCGAG
GAAGAGAAGCACGCTGCAGACCGTCATCAGCGCCGTGCTATCGATTCATTGCGTTCCCGGATCAAACGCCTCGAT
CCCCCTGTCCGTGCAACTGATACTTGGGAACAGGTGCGGCCAAGAATCGAAAGATTCGATGAGTACAAGTCTCTG
GAGACCGATGAGCTCCGACAGGCCGCCTTTGACAAGGTTATTCGCCGCCTGAAGGAGAAGGAGGAGGACGCGGAA
CGAGACCGCGAGACCCGCGACAGGGATCGCGGAAGTCGCCGTGATCACCACGACCGTGATCGTGATCATCGCAGC
GGGCCATCCTATAGAGGCGAAAGAAGGGGAACATCTAGCCGTCTTAGCCGAACCCCAGAACCAGATGCCTACGAG
GCAGATCGCCGTAAAGCCCAAGCAGACCGTGAACGCTCCTACCGGAAGGCCAGCGGTCTATCACCCGTCCGAGAG
CGACGGGAAGAGCGTGATCGAGACAGGGAACGTTACCGTGAGCGTGAGCGGGATAGGGACCGCGATCGCGACTGG
GACCGTGATCGCAGCGCACGTCCTCTTAGCCACTACGAACGCGAGCGTCGCGAGCGCGAGGAAGAGCGCGAACGC
CTCTATCGCACACGCGGTGATCCCCGCGGAGGTCGGGATGAGCTGGATTATGGTGCCGATACCAAGAGCACCACA
AGCAATGATCGTAGGCGCAGACGCGACAGCGACACCGAAAGTGTTGCCAGTCGCTCTGCAAAGCGGTACCGACGT
GATAGTCGGGAGCGCGAACGCAGCCGGGGTGCCAGGCGAGATCGAGACCGTCGCGAGCGGACTCCAGCGGCGACC
GATGATGGAAAGAAAGAGGAAAAGGCCGTCCACTCCGGTAGTGAAGAAGGGGAGATTGAAGAAGATTAA
Gene >Ani_SJS100_1|g1772.t1
ATGAATCCCATGAACGGTCCGGCTGGCGCGCCCTCCATGTGGCAGGAGGCGCGTAACTCTGACGGTCGAGTTTAC
TACTACAATGTACAGACGAAGGCGACGCAATGGGCGAAGCCCATCGAGCTGATGACGCCTGTAGAGGTATGTGTC
CTCAAGCTTCTTTTTCTTCATGACATTGCCATATATTATATGTCCTGGATGCTAATCCTCTGTTAATCTCCTATA
GCGTGCCTTGGCAAACCAGCCGTGGAAGGAATATACTGCTGAGGGTGGTCGGAAATACTGGTACAACACCGAAAC
CAAGCAAAGCACGTGGGAGATGCCAGATGTTTACAAAACTGCTCTGGCACAGGCTCCAGCGCCTCAGGCTCCTCC
AGTGGCGTAAGTCTACAGCCAAATTTTCCTCTCAATGCGCTCATGATACTGACGTGACTATGCATAGGGGTCCGA
CTTTCGTTGCAGGTGGTGTTAGCTCCTTTTCTTCCTACCCACAACAGCGTGACCGCGACGACTATGATCGAGGCT
ATGGCGACCGACGTGGAGGATATGGTTCGATGGATACCAATGGCATCGCCGCGGCCCCTGTCCTAGGTACACAGC
AAGCCGAACCGGAATACGGCTCTCTCGAAGAGGCAGAGAGCGCATTCATGAAAATGCTGAAGCGCCACAACGTGC
AACCCGACTGGAGCTGGGAACAGACCATGCGTGAAACCATCAAGGATCCCCAGTATCGTGCCCTCAAAGACCCCA
GAGACCGCAAGGCAGCATTTGAAAAATATGCGGTCGAGGTTCGCATGCAGGAAAAGGATCGGGCGAAAGAAAGAT
TCGCTAAGCTCAGAGCAGATTTTAATACCATGCTGAAGCGCCATCCTGAGATTAAACATTACAGTCGCTGGAAGA
CCATCCGACCGATCATCGAGGGCGAAACGATCTTTAGATCTACAGATGATGAAAACGAGAGGCGCCAGCTCTTCG
AGGAATACATTGTTGAGCTCAAGAAGGAGCACATCGAGGAGGAAGCTGTTAAGCGCAAAGCTGCTATGGATGAGC
TGGTGACTATCTTGAAGTCCCTGAACCTGGAACCATACACACGCTGGTCTGAAGCACAGGCGATTATTCAGTCAA
ATGACAAAGTCCAAAGCGATGATAAATTCAGAACCCTGAGCAAGTCCGATATTTTGACTGCATTCGAGAACCACA
TCAAGTCCCTTGAGCGGGCCTTCAATGATGCGCGTCAGCAACAAAAGGCTGCAAAGGCGAGAAAAGAGCGTCATG
CCCGCGAGCAGTTTATCGAGCTTCTGAAAGAGCTGAGATCTCAGGGTAAGATTAAGGCCGGAAGCAAGTGGATGA
ACATCTACCCCTTGATCCACGAGGATCCTCGGTACGTTGGTATCCTGGGTAACTCCGGATCTTCTCCCCTGGATC
TATTTTGGGATATGGTTGAAGAAGAAGAACGCTCGTTGCGTGGCCCGCGTAACGATGTCTTGGATGTACTTGATG
TAAGTCTGATTAAGCCTGGTATTCTGTTCATCTGTCACTAACACGTACTCAGGACAAACGCTTCGAGGTTACACC
AAAGACCACTCTTGAAGAGTTCAACGCTGCTGTATCCGGTGATCGCCGCACGGCCAATATTGATCCCGAGATACT
TGAACTGATTTTCCAGCGTATCCAGGAGAAGGCTGTCCGACGAAGCGAGGAAGAGAAGCACGCTGCAGACCGTCA
TCAGCGCCGTGCTATCGATTCATTGCGTTCCCGGATCAAACGCCTCGATCCCCCTGTCCGTGCAACTGATACTTG
GGAACAGGTGCGGCCAAGAATCGAAAGATTCGATGAGTACAAGTCTCTGGAGACCGATGAGCTCCGACAGGCCGC
CTTTGACAAGGTTATTCGCCGCCTGAAGGAGAAGGAGGAGGACGCGGAACGAGACCGCGAGACCCGCGACAGGGA
TCGCGGAAGTCGCCGTGATCACCACGACCGTGATCGTGATCATCGCAGCGGGCCATCCTATAGAGGCGAAAGAAG
GGGAACATCTAGCCGTCTTAGCCGAACCCCAGAACCAGATGCCTACGAGGCAGATCGCCGTAAAGCCCAAGCAGA
CCGTGAACGCTCCTACCGGAAGGCCAGCGGTCTATCACCCGTCCGAGAGCGACGGGAAGAGCGTGATCGAGACAG
GGAACGTTACCGTGAGCGTGAGCGGGATAGGGACCGCGATCGCGACTGGGACCGTGATCGCAGCGCACGTCCTCT
TAGCCACTACGAACGCGAGCGTCGCGAGCGCGAGGAAGAGCGCGAACGCCTCTATCGCACACGCGGTGATCCCCG
CGGAGGTCGGGATGAGCTGGATTATGGTGCCGATACCAAGAGCACCACAAGCAATGATCGTAGGCGCAGACGCGA
CAGCGACACCGAAAGTGTTGCCAGTCGCTCTGCAAAGCGGTACCGACGTGATAGTCGGGAGCGCGAACGCAGCCG
GGGTGCCAGGCGAGATCGAGACCGTCGCGAGCGGACTCCAGCGGCGACCGATGATGGAAAGAAAGAGGAAAAGGC
CGTCCACTCCGGTAGTGAAGAAGGGGAGATTGAAGAAGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail