Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g1769.t1
Gene name
Locationscaffold_006:633253..634685
Strand-
Gene length (bp)1432
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00162 PGK Phosphoglycerate kinase 1.5E-151 9 406

GO

GO Term Description Terminal node
GO:0006096 glycolytic process Yes
GO:0004618 phosphoglycerate kinase activity Yes
GO:0009132 nucleoside diphosphate metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0009056 catabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008152 metabolic process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0006082 organic acid metabolic process No
GO:0009987 cellular process No
GO:0006091 generation of precursor metabolites and energy No
GO:0046939 nucleotide phosphorylation No
GO:0019637 organophosphate metabolic process No
GO:0003674 molecular_function No
GO:0044281 small molecule metabolic process No
GO:0016740 transferase activity No
GO:0019752 carboxylic acid metabolic process No
GO:0016774 phosphotransferase activity, carboxyl group as acceptor No
GO:0009185 ribonucleoside diphosphate metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0044238 primary metabolic process No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006090 pyruvate metabolic process No
GO:0016301 kinase activity No
GO:0009135 purine nucleoside diphosphate metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:1901575 organic substance catabolic process No
GO:0046031 ADP metabolic process No
GO:0032787 monocarboxylic acid metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0003824 catalytic activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016310 phosphorylation No
GO:0046483 heterocycle metabolic process No
GO:0006165 nucleoside diphosphate phosphorylation No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006757 ATP generation from ADP No
GO:0008150 biological_process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0046034 ATP metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009179 purine ribonucleoside diphosphate metabolic process No
GO:0016052 carbohydrate catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g1769.t1
MSLTNKLAITDVDLKDKRVLIRVDFNVPLNDKKEITNNQRIVGALPTIKYAIENGAKAVVLMSHLGRPDGKKNDK
YSLKPVVAELEKLLGRSVVFTEDCVGPEAEEAVNKATGGQVVLLENLRFHAEEEGSSKDAEGKKVKADKEKVAEF
RKGLTALGDVYINDAFGTAHRAHSSMVGVDLPQKASGFLVKKELEYFAKALESPQRPFLAILGGAKVSDKIQLID
NLLPKVNSLIITGAMAFTFKKTLEGVKIGNSLFDEAGSKIVGEVVEKAKKHDVKIVLPVDYVTADKFAADAKTGT
ATDAEGIPDGYMGLDVGEKSVELYKQTIAEAKTILWNGPPGVFELEPFANGTKKTLDAVVSAAQSGSIVIIGGGD
TATVAAKYGVEDKLSHVSTGGGASLELLEGKELPGVAALSSK*
Coding >Ani_SJS100_1|g1769.t1
ATGTCTCTTACCAACAAGCTCGCTATCACCGATGTCGACCTCAAGGACAAGCGTGTCCTGATCCGGGTCGACTTC
AACGTCCCCCTCAATGACAAGAAGGAGATCACCAACAACCAGCGTATCGTCGGTGCTCTGCCCACCATCAAGTAC
GCTATCGAGAATGGTGCCAAGGCCGTTGTCCTCATGTCCCACCTGGGCCGCCCCGACGGCAAGAAGAACGACAAG
TACAGCCTGAAGCCCGTTGTTGCCGAGCTGGAGAAGCTGCTTGGCCGCAGCGTTGTCTTCACCGAGGACTGCGTT
GGCCCGGAGGCTGAGGAGGCCGTCAACAAGGCCACTGGTGGCCAGGTTGTTCTCCTTGAGAACCTGCGTTTCCAC
GCTGAGGAGGAGGGCAGCTCCAAGGATGCCGAGGGCAAGAAGGTCAAGGCCGACAAGGAGAAGGTCGCTGAGTTC
CGCAAGGGTCTGACTGCTCTTGGTGATGTCTACATCAACGACGCTTTCGGCACTGCCCACCGTGCTCACTCTTCC
ATGGTCGGTGTTGACCTTCCTCAGAAGGCTTCCGGTTTCCTCGTGAAGAAGGAGCTCGAGTACTTCGCCAAGGCT
CTCGAGAGCCCCCAGCGCCCCTTCCTTGCCATCCTGGGTGGTGCCAAGGTCTCTGACAAGATCCAGCTGATCGAC
AACCTGCTGCCCAAGGTCAACAGCCTGATCATCACCGGTGCCATGGCTTTCACTTTCAAGAAGACCCTCGAGGGT
GTCAAGATCGGAAACAGTCTCTTCGACGAGGCTGGCAGCAAGATCGTTGGCGAGGTCGTCGAGAAGGCCAAGAAG
CACGACGTCAAGATCGTTCTGCCCGTCGACTACGTCACTGCCGACAAGTTCGCTGCTGATGCCAAGACCGGCACT
GCTACCGACGCTGAGGGTATTCCCGACGGCTACATGGGTCTGGATGTTGGCGAGAAGAGTGTTGAGCTCTACAAG
CAGACCATTGCTGAGGCCAAGACCATCCTCTGGAACGGTCCCCCCGGTGTCTTCGAGTTGGAGCCCTTCGCCAAC
GGCACCAAGAAGACCCTCGATGCCGTCGTCTCCGCTGCTCAGTCCGGCTCCATCGTCATCATCGGAGGTGGTGAC
ACTGCCACCGTTGCCGCCAAGTACGGTGTCGAAGACAAGCTTAGCCACGTCTCCACCGGTGGTGGTGCCTCTCTG
GAGCTCCTGGAGGGCAAGGAGCTGCCCGGTGTTGCTGCCCTGTCGAGTAAGTAA
Transcript >Ani_SJS100_1|g1769.t1
ATGTCTCTTACCAACAAGCTCGCTATCACCGATGTCGACCTCAAGGACAAGCGTGTCCTGATCCGGGTCGACTTC
AACGTCCCCCTCAATGACAAGAAGGAGATCACCAACAACCAGCGTATCGTCGGTGCTCTGCCCACCATCAAGTAC
GCTATCGAGAATGGTGCCAAGGCCGTTGTCCTCATGTCCCACCTGGGCCGCCCCGACGGCAAGAAGAACGACAAG
TACAGCCTGAAGCCCGTTGTTGCCGAGCTGGAGAAGCTGCTTGGCCGCAGCGTTGTCTTCACCGAGGACTGCGTT
GGCCCGGAGGCTGAGGAGGCCGTCAACAAGGCCACTGGTGGCCAGGTTGTTCTCCTTGAGAACCTGCGTTTCCAC
GCTGAGGAGGAGGGCAGCTCCAAGGATGCCGAGGGCAAGAAGGTCAAGGCCGACAAGGAGAAGGTCGCTGAGTTC
CGCAAGGGTCTGACTGCTCTTGGTGATGTCTACATCAACGACGCTTTCGGCACTGCCCACCGTGCTCACTCTTCC
ATGGTCGGTGTTGACCTTCCTCAGAAGGCTTCCGGTTTCCTCGTGAAGAAGGAGCTCGAGTACTTCGCCAAGGCT
CTCGAGAGCCCCCAGCGCCCCTTCCTTGCCATCCTGGGTGGTGCCAAGGTCTCTGACAAGATCCAGCTGATCGAC
AACCTGCTGCCCAAGGTCAACAGCCTGATCATCACCGGTGCCATGGCTTTCACTTTCAAGAAGACCCTCGAGGGT
GTCAAGATCGGAAACAGTCTCTTCGACGAGGCTGGCAGCAAGATCGTTGGCGAGGTCGTCGAGAAGGCCAAGAAG
CACGACGTCAAGATCGTTCTGCCCGTCGACTACGTCACTGCCGACAAGTTCGCTGCTGATGCCAAGACCGGCACT
GCTACCGACGCTGAGGGTATTCCCGACGGCTACATGGGTCTGGATGTTGGCGAGAAGAGTGTTGAGCTCTACAAG
CAGACCATTGCTGAGGCCAAGACCATCCTCTGGAACGGTCCCCCCGGTGTCTTCGAGTTGGAGCCCTTCGCCAAC
GGCACCAAGAAGACCCTCGATGCCGTCGTCTCCGCTGCTCAGTCCGGCTCCATCGTCATCATCGGAGGTGGTGAC
ACTGCCACCGTTGCCGCCAAGTACGGTGTCGAAGACAAGCTTAGCCACGTCTCCACCGGTGGTGGTGCCTCTCTG
GAGCTCCTGGAGGGCAAGGAGCTGCCCGGTGTTGCTGCCCTGTCGAGTAAGTAA
Gene >Ani_SJS100_1|g1769.t1
ATGTCTCTTACCAACAAGCTCGCTATCACCGATGTCGACCTCAAGGACAAGCGTGTCCTGATCCGGGTATGTTGT
TGTTGCCCCGGAAACCCCCACCTTTTCATCAGTCACCGTCGTGGGGTTTAAGATGAGCCTTCAATGCTAACTAGT
CTGCTCACTGGACAGGTCGACTTCAACGTCCCCCTCAATGACAAGAAGGAGATCACCAACAACCAGCGTATCGTC
GGTGCTCTGCCCACCATCAAGTACGCTATCGAGAATGGTGCCAAGGCCGTTGTCCTCATGTCCCACCTGGGCCGC
CCCGACGGCAAGAAGAACGACAAGTACAGCCTGAAGCCCGTTGTTGCCGAGCTGGAGAAGCTGCTTGGCCGCAGC
GTTGTCTTCACCGAGGACTGCGTTGGCCCGGAGGCTGAGGAGGCCGTCAACAAGGCCACTGGTGGCCAGGTTGTT
CTCCTTGAGAACCTGCGTTTCCACGCTGAGGAGGAGGGCAGCTCCAAGGATGCCGAGGGCAAGAAGGTCAAGGCC
GACAAGGAGAAGGTCGCTGAGTTCCGCAAGGGTCTGACTGCTCTTGGTGATGTCTACATCAGTAAGTCATCCTTT
TCTCACACCTTCCATCTTGGGAGGCCACTAGTTTATGAGCTGTGTACTAATATTCCACACCACAGACGACGCTTT
CGGCACTGCCCACCGTGCTCACTCTTCCATGGTCGGTGTTGACCTTCCTCAGAAGGCTTCCGGTTTCCTCGTGAA
GAAGGAGCTCGAGTACTTCGCCAAGGCTCTCGAGAGCCCCCAGCGCCCCTTCCTTGCCATCCTGGGTGGTGCCAA
GGTCTCTGACAAGATCCAGCTGATCGACAACCTGCTGCCCAAGGTCAACAGCCTGATCATCACCGGTGCCATGGC
TTTCACTTTCAAGAAGACCCTCGAGGGTGTCAAGATCGGAAACAGTCTCTTCGACGAGGCTGGCAGCAAGATCGT
TGGCGAGGTCGTCGAGAAGGCCAAGAAGCACGACGTCAAGATCGTTCTGCCCGTCGACTACGTCACTGCCGACAA
GTTCGCTGCTGATGCCAAGACCGGCACTGCTACCGACGCTGAGGGTATTCCCGACGGCTACATGGGTCTGGATGT
TGGCGAGAAGAGTGTTGAGCTCTACAAGCAGACCATTGCTGAGGCCAAGACCATCCTCTGGAACGGTCCCCCCGG
TGTCTTCGAGTTGGAGCCCTTCGCCAACGGCACCAAGAAGACCCTCGATGCCGTCGTCTCCGCTGCTCAGTCCGG
CTCCATCGTCATCATCGGAGGTGGTGACACTGCCACCGTTGCCGCCAAGTACGGTGTCGAAGACAAGCTTAGCCA
CGTCTCCACCGGTGGTGGTGCCTCTCTGGAGCTCCTGGAGGGCAAGGAGCTGCCCGGTGTTGCTGCCCTGTCGAG
TAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail