Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g1768.t1
Gene name
Locationscaffold_006:632012..632544
Strand+
Gene length (bp)532
Transcript length (bp)267
Coding sequence length (bp)267
Protein length (aa) 89

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05160 DSS1_SEM1 DSS1/SEM1 family 2.5E-24 19 82

GO

GO Term Description Terminal node
GO:0006406 mRNA export from nucleus Yes
GO:0043248 proteasome assembly Yes
GO:0008541 proteasome regulatory particle, lid subcomplex Yes
GO:0051028 mRNA transport No
GO:0051169 nuclear transport No
GO:0051649 establishment of localization in cell No
GO:0051236 establishment of RNA localization No
GO:0015931 nucleobase-containing compound transport No
GO:0032991 protein-containing complex No
GO:0071840 cellular component organization or biogenesis No
GO:0071705 nitrogen compound transport No
GO:0006810 transport No
GO:0065003 protein-containing complex assembly No
GO:0009987 cellular process No
GO:0050657 nucleic acid transport No
GO:0016043 cellular component organization No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0051168 nuclear export No
GO:0043933 protein-containing complex organization No
GO:0005575 cellular_component No
GO:0006405 RNA export from nucleus No
GO:0046907 intracellular transport No
GO:0051641 cellular localization No
GO:0050658 RNA transport No
GO:0022607 cellular component assembly No
GO:0006913 nucleocytoplasmic transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g1768.t1
MSNPTATQDTKAEPTQQPQQQKPPVLEEDDEFEDFPVEDWPQEETEQGSAANGASAHLWEESWDDDDAAEDFSKQ
LKEELKKVGASNQ*
Coding >Ani_SJS100_1|g1768.t1
ATGTCGAATCCCACCGCGACCCAGGACACCAAGGCCGAGCCTACCCAACAGCCACAGCAACAGAAGCCCCCCGTG
CTGGAAGAAGATGACGAGTTTGAGGACTTCCCCGTTGAAGACTGGCCCCAGGAGGAAACCGAACAAGGATCTGCT
GCCAACGGCGCAAGCGCTCATTTGTGGGAGGAGAGCTGGGATGATGACGATGCGGCCGAGGACTTCTCGAAGCAA
CTGAAAGAGGAGCTGAAGAAGGTCGGGGCGTCTAATCAATAG
Transcript >Ani_SJS100_1|g1768.t1
ATGTCGAATCCCACCGCGACCCAGGACACCAAGGCCGAGCCTACCCAACAGCCACAGCAACAGAAGCCCCCCGTG
CTGGAAGAAGATGACGAGTTTGAGGACTTCCCCGTTGAAGACTGGCCCCAGGAGGAAACCGAACAAGGATCTGCT
GCCAACGGCGCAAGCGCTCATTTGTGGGAGGAGAGCTGGGATGATGACGATGCGGCCGAGGACTTCTCGAAGCAA
CTGAAAGAGGAGCTGAAGAAGGTCGGGGCGTCTAATCAATAG
Gene >Ani_SJS100_1|g1768.t1
ATGTCGAATCCCACCGCGACCCAGGACACCAAGGCCGAGCCTACCCAACAGCCACAGCAACAGAAGCCCCCCGTG
CTGGAAGAAGATGACGAGTTTGAGGACTTCCCCGTTGAAGGTTAGCCACAAACCACACAGACCGCTGGTCTTTCC
TGTCATGCAGAAGAGGGAGCTTCGCTCCGCCCAGACAGCCGGCAAAATGATCTTACGGATGACGGGTTGCGCTGA
CCTCGGAGCTTTAATTGCAGACTGGCCCCAGGAGGAAACCGAACAAGGATCTGCTGCCAACGGCGCAAGCGCTCA
TTTGTGGGAGGAGAGCTGGGATGATGACGATGCGGCCGAGGACTTCTCGAAGCAACTGAAGTACGTTTTCCCAAG
CCAAGCCAAACCGAACCAAACCAAACCTCATCGGTCAATGCTATGAGCGCAATATGTTACCATTGATCTACACCT
CATCTAAAGCTCAAATTGGACTAACATGTTTGCTTCAAACTACAGAGAGGAGCTGAAGAAGGTCGGGGCGTCTAA
TCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail