Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g1765.t1
Gene name
Locationscaffold_006:605469..624792
Strand+
Gene length (bp)19323
Transcript length (bp)18633
Coding sequence length (bp)18633
Protein length (aa) 6211

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00668 Condensation Condensation domain 2.1E-28 822 1248
PF00668 Condensation Condensation domain 3.3E-40 1293 1720
PF00668 Condensation Condensation domain 3.7E-10 2519 2761
PF00668 Condensation Condensation domain 7.2E-36 3438 3852
PF00668 Condensation Condensation domain 6.1E-34 4511 4933
PF00668 Condensation Condensation domain 5.3E-53 4978 5401
PF00668 Condensation Condensation domain 2.1E-34 5634 6049
PF00501 AMP-binding AMP-binding enzyme 5.8E-53 255 571
PF00501 AMP-binding AMP-binding enzyme 7.0E-41 1741 2138
PF00501 AMP-binding AMP-binding enzyme 1.3E-73 2782 3185
PF00501 AMP-binding AMP-binding enzyme 4.8E-80 3873 4273
PF00550 PP-binding Phosphopantetheine attachment site 1.7E-08 738 802
PF00550 PP-binding Phosphopantetheine attachment site 6.4E-08 3331 3386
PF00550 PP-binding Phosphopantetheine attachment site 4.4E-08 4429 4490
PF00550 PP-binding Phosphopantetheine attachment site 6.5E-08 5504 5565

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g1765.t1
MAQPVSCCLPKFGTSTHGPRRPASLRIRTSPSQTLQLLAAWDQSELDSLLKATWALLLHRYTGLEDICFGYQPIG
VDAGPRDTVTSSDTHNNIPLTFNLTITEDDSVHAILRNTKKQNEAEKCGSSSSSCHSYTLCNTLLMLRNCRSVTK
DPRAPLVQPALAIPLPEKCRVRLHVKVLQKDVGIFFEWWNNDMSTEHMKSVADYFEQILSRILSAEDTAARDLNH
FSDRDWSRVCNFNSTIPQAHDRCIHEVIHEQVLARPGSEAVCAWDGSLTYQDLDLLSSQVAYHLQAHGVGPEKCV
ALCFNKSKWNVVAMLGVLKAGGAFVPLDPTHPTSRLQSLVHAVQAKVMLCSRDRIGELTGVAEMIIPLDQAIIDE
ISLQAEEIYSLPDVQGHNAAYVIFTSGSTGEPKGTMLEHRAYVSGAAAHAGPHHMFSTSRVLQFAAHTFDASLVE
ILTTLLQGGCVCIPSEEERLSDIVKVINEMNINHAILTPSFVEFIDSSQVPGLETLILAGEAMSQGQLETWSSAL
HLINAYGPTESSVAAVVNAKVTPSSDCRDIGLPVGKTSEAFIHDPAWMRRDGLNDCNRRVYKTGDLVKFHGQRLE
LGEIENQLAADPIVKHCLAFLSKSGFSAGKLVAVISLSVHFESQPESNAAPLKLLDTSKKTSIVAEVRERLSAKL
PTYMIPSVWLCVEALPLLPSGKLDRKATARWIGDMERDPYAQAISARTLSADKATLPSSATEDKLAAIWSRVLNI
PRSQLALDEGFLSLGGDSIAAITCLGYCKKQGMGLTVQEVLHSKSIKELATRVKQIDQFVVYEEKIDEPFDLSPI
QKLHFMVRNEGQGHFNQSILTRLNRHIDEHSMRRAIETIINRHSMLRARLVESDVEGIMRQRITQDVAGSYRWRS
HNNSNRSEVDHAISNSQSCINAFVGPVLAIDVFYGNDHSRLLSLVAHHMVVDIVSWRIILEDLEDLLMNPDQPIS
QNGSLPFQNWCQIQADRCQEATAERTMDLPEVPAPDFAYWGLKSHQTTYGDVDCETFDLDSDITRHILTGCHESL
QTEPIDLFLAALLHSFGETFKDRSLPVIYNEGHGREVWDSSIDISRTIGWFTTLYPILLSELPAKDPTETVVRVK
DLRRCVPDNGRHDFARRMLVPREDGTCRHYSPMEMSFNYVGQHRDLQRKDGLFQLMDQMAGETGRGGAAADFGEE
TPRFALFEISAMVVQGQLRFIFSFNRNMQHQNGIRNWVHCCKTLLASLGERLQALPPKPTLSSFPMLTLTYTELD
ALVSKKLPDAGIHSLDDVEDIYPCSRMQQGILLSRSRDSSLYAVHDTFEISGPGSTPDINRLILAWQKVVAHHAM
LRTIFLEGLSSHDLHCQVVLKSFDSRPTYVVCANESEVLPTFDKQQPMSYDNNIPPHRLTICQTASGKLFCRLEL
NHVAMDGASISIILRDLQLAYQGKLEEPKPKFKEYIRYLREVPQVASLDYWRNYLLDVQPCHFPVLNDGKGSVRQ
LRTKRLGGVPFKELRTICDMNGLTLPTAFSAAWGLTVRSFCGSDDISFTYLASLRDVPVEGVEYVVGPVINTLTC
RMLFAKGTSLKEILAKVQQDNLDNLPHRHISLTEIQQALGLTASLANSGISYRKLPNQNALSSEEIQFSEVGTIH
DPAESPVFVNVEATEDDARIDLNYWTDHLSDGQAENVASTFLKSVENIVHHFEDDAHSIDNFSDANRQSLMLWNS
EVPKSIDKCMHEIVDECAKSHPHTMAISAWDGNLTYAKLNELSSLLATYLTTLGVGPGTIVPLDLARSSWQVVAI
LAVMKTGGVCVPVNPARLPQHFETWLVDNEIQVALASPTQMQLLEGAVPYVISVESSLFEYLSDSDAVSSSPIQP
CSDAYIVFGAESPKCILIDHRAITTRASAFASGLGLNARTKMLQYAPYTSDMFLQEVFGTFLCGGSICIPSDEDL
ADLSKTIKTMQANCVSITPSTAMTLRSAEDLGIEVLALWGEHPTKQLLTALPGGIQVHAFYGTPECSSSCIRSSQ
LDGSCESSIIGSSLGCKSWLVDPSDHDILVPIGCVGELMIEGPSLSHGYYQDAELTQQYFVENPLWRLAYESQPS
SDKDKNTDAQKLSYRLFKTGDLARYNSDGTLVYVGKKNRGLHWQRQTAAIYVEEQIASLSSFNAQYVVEEISKSN
VDSPRSSLAIFFSDEAVDSKGHHQPIAQLSPELHDTMIRLYKKLSSSLPANSVPRLYFPTSSIPLNSFGKLDRQL
LRNAAQNLPEELLSRFDIKSFDSFWKGQLATLALSPVFPSPRGSSSQRSTPVTKQATKNMQMVWCDTLRSMTEGT
RCAILSAWALTIRGYISSRDIVFGELLSEVELASTERQDNYTQAATIVPRRFQLNDDWTITELLSRVKYQLESAK
PYQWAGISQIQKLNADTARACDFMNLISITDNRGLEPRLVPMKQHDSNLSGYPLMVDCILGDATLELLISYNDST
LTGTQIERLAAQFFACVGLLNSKASMNKTIGVLSRDNMDFCSFRHDVAYWKNYLEDVEACLFPALRASAEENTHA
ETQIILQNTKHLHDLSERERLSKSSLLQLVWGLVLRCYTGLQDVCFGYHIPDASDRSAKPGVANKPDISGTFPCR
MLLNGESRVAEILRERLQGLNQMQQHRLPWDEVQQELGCSDIFNTVFTCSEQSSDAVNVAGLADLDPSKYLITVN
ATLAESSGVIRFGYQRRHFSETDMEGVLDCFNNILGQLLQFPLPDLLVGEVDFVSELSCQKISEWNSALPDRPVL
CAHELIQQQALDRASAPAICSWDGNFTYAQLDRLSTLLANQLVGLGVKPDIFVALCFEKSAWAVVAQVAVLKAGG
AFASLDPAHPESRLQGMIDDLGAQVILCSETHYERASSICRRAMIVSNSALEQLHHSPFAAPTQEVTADNAAYAI
FTSGTTGKPKVTVLEHVGLTLACTELSRAFFISSETRALQFSSYTFDVSILETIIVLAAGGCICIPSEDERMNNL
SGAIRKMNVNFMSCTPSIVNTMDPNAVPSLRTITLGGEKMTASHFERWADRCVINAYGPSEATVAFTSSTKYDHA
GVRLTDDYGSIGTAICGRTWIVDPQNHNRLVPIGAPGELVLESCTVARGYLNNDEKTKAVFIRDPEWTQREGLQH
VLRRKERMYRTGDLVRYNSDGSIAFISRIDTQVKLNGVRIELEEVEQQCNNYLSTDTQVAVEVVTPEAKTISKCL
AVFFTIDEHQMKDMANGEFILPMSESVVHMVKKLHGSLSASLPLAMVPKLYFPMRRLPFGSTGKTDRKALRAMVD
TFTKERLRPYVIFNVGAEERSDVGTEGTDSVLKTLWEEVLNLAPGSISAEDNFFGMGGDSFSAMKLVVAAASQNI
SLAVADIYRTPIFKDMAKRCGAGEVKTGVPTVDPFSMLPESLPRDDILEEVSDQCGVPMDRIADIYPCSPVQEGL
LTLSIKQPGAYVARPVFQLAEGADLDKFKAAWQKVVNEMDILRTRVVHTESANFVQAVLTDVPILWETATELDDL
ANDTIDLAKNNGGLLTGYAIVESGHSRSFVWTIHHALYDGWSVSQILQRVEEIYSGASKLSSTLPYKLFINHLVQ
QEAHSSDEFWKTHLAALSSCPFPQNKPSPDTIRVGNRHYSSLEISRASSGPKLTVPEMIRAAWALIVSVHTGSGD
VCFAETLMGRNIDMPGAMEVAGPLLTTVPIRMAVNNELSIIQYLDNVRQLTTMMLPHQHSGLQRIRKLSSDTALA
CESQNLLVIQSEQAHSNTSIWEQKDNLTEGEFFTHPIVVECKVGESQVAVTLHHDELVFDSWQAKMLIEQFTFVL
SQLLSISNEESRKIGELEVSSSRDKEEIALWNERNLTCIDRCVHHIIEEKASLRPQAQAVCSWDGQLTYQELYQL
ASSFAAYLKTRGVGPETLVPICMDKSLWAIVTILGVLIAGGGYVPLDPAHPTSRHKEILTEVEARVVLCSPKYQS
RYTGSVKAIIPVSKETIKAYCALRTATAKTTNNATPENVAFAIFTSGSTGRAKGIIINHKALASSGMAFGPMVHL
DENSRAFQFASLTFDAAVMETLVTLMHGGCVCIPSEDERLNDVAGAIRRMNVSWSFLTPSIASIIEPSSVPSLRD
LVCGGEKMSREVITKWAHRVNLMNGYGPTETTIFAVINTDVAANPDPACIGHGIPCTLTWVVDPDDHNKLTPLGA
VGELALEGPALAREYLKNPKKTAEAFVDEPEWIKAFPSVLPSPRRIYKTGDLVRYNSDGSIQYISRKDHQVKLHG
QRMELGEIEHRLYEDPRVRHAVVLLPTAGPLKQRLVTVLSLNSVTAEKSIISDNACELVDRGGSARAAYQELVAI
QKSLETQLPIYMVPQAWALIKQLPMLVSGKLDRKRITAWLENVDDAAYDRIMEDYDNIKRGDVEQDEEKEDDRET
SVKLLQEVFSQVLNLPSHKVGLDKSFVSLGGDSITGMAVISRARKHGLTLTLHNVLQSKSIKELSLAAQTSVKTV
KREEKPHEYFELSPIQGLFVQTTTNFRDSSRFNQSMTVRVTRRVEPTRMQSAIKAVVEQHSMFRARFFKSRDGKW
KQKISDDVDASYRFRHHMVENKDAILPKIAECQRSVDAQHGPIVAADMVQVRNGITILFLVASHLCVDMVSWRIV
LQDIQDFLDAGSLCPEKPLSFQAWCNLQLEQSKKPNGRVQLPFSIQPPDLKYWGMEQSQNLYGDVKMEGFTLDAA
VTTQILAACNKVLRTEAIEVILSAVIHSFRRTFTDREMPTIYNEGHGREAWDSSIDLSRTVGWFTTMCPLHVGEG
SDLLDTLKRVKDTRRHLSSKSRSYFAESLLQPEGKEGDAFPVPLEILFNYLGQLQQLERDDSLFQHYGEAFNAET
FEMTGDMGSKTPRFALFEISALIIKNKLQVSFTYNKHMQKEQRIKGWISECKRVLEHMSRFESFTSEPTLSDCPL
LPITYEGLNNMVKRAFPKIGIDSWDQVEEVYPCSPVQEGILLSQLRDPEEYLFHVIFEVHPSKGSKVDTSKLRKA
WSMVVSRHPILRSVFIDSNYKGGSFDQVVVKSLDDEVIEFQCPESDALGTLGEIKLRDINAERSMKLAHQMTLCK
TTSGRVLFKIEMNHAIIDGGSVDLLLRDLALAYSDQLSAGTGPRFSDYVKYIREQSQGEAVAHWVKYLSGVRPCH
LLVSSKKSGSHQLGERMISFKRFSELQRFCEENSVTLANLTLCAWAIVLRNCTGSDDVCFGYPSAGRDSPVPGIQ
DAVGIFINMLCCRVKFSPGQTLLEIAKKVQDDFVRNVPHQHCSLAQIQHELGMHGETLFNSTLSIQSRSANKGTG
NLPLDFDAQKAHDPTEYPVTVNVETTKGKEGVLLRYWSNAVTEAQAKELAEAVTKVFTCFIEEPSKPVSSLNLLN
KLPRNRSQHTHREPLILDQLIDSQVLQKLIDDRVNEIISQMLKEGKLAIPLPDQKTRYSNSSVQLKMVEASLQKD
PIIDEKDLANSTPSLTDDGRSSSDNDRRLWDLWKSTLGLSSDTIQYRSSFFKLGGDSITAMKMVSAAREEGLQMT
VADVFNNPIFEDMLATITPSSSPTSNADTQCANNIEKLLEVDDALPDATPPQDISVLRPMQLDAMSLLDVICPKI
GVFKGGIADVLPVTDFQSMSIAATLFGSRWMLNYFFLDGSGPLDLRRLRESFLRVVDAFDILRTVFVCHHGQFFQ
VVLRKVRPDIFVHETEQSLDEYTNGLQKRDREQDPRQGEQYVQFYVVKKKNSDQHRILIRMSHAQFDGVCLPKIM
NAIKLGYEGSTLPPVFSFSNYMRMLPGNITPAHYHHWSTILKGSKMTDIIRRTQPNTFMHIGAFAEQKKTIMIPS
TAIGNVTLATVMQSAWAVTLAKLTAQSDVVFGLTVNGRNASVPGIETTVGPCLNILPIRVKFREHWTGLDLFRYL
QDQQIANMPYESLGFREIIRNCTDWPDSTYFTTSVFHQNVEYEGQMHLDGNSYRMGGVGVLDNFTDLTLASKSCG
QEKLDVSIGYSLKGPIPATFIAKALNMVCETVQSLIANPSVPLASPATIRSLPSQIIRETPRASDTPFLSSNLNS
QKMSEIVIHSDILTRSWQQVLPRQTDNPQYQLDASFFDLGGDIMNVAQLVWILGEEGFSVRLEDLLEHHTFLGMM
AVMAMHHKPELNARMAATMAEEPAKEMRMTMTKSNSWSSLGKAMTLAKRFTRWGAVAAKK*
Coding >Ani_SJS100_1|g1765.t1
ATGGCCCAACCTGTCTCTTGTTGCTTGCCCAAGTTTGGCACGAGCACTCATGGGCCAAGGCGGCCTGCTTCGTTG
AGGATCAGGACGAGTCCTTCCCAGACTCTCCAGTTGCTAGCCGCTTGGGACCAATCCGAGTTAGATTCTTTACTC
AAGGCCACTTGGGCCTTGCTTCTTCATCGCTATACTGGCCTAGAGGACATTTGCTTTGGTTACCAACCGATTGGA
GTTGATGCCGGTCCCCGCGATACTGTTACTTCTTCCGATACCCATAATAATATTCCCTTAACTTTTAATCTGACC
ATTACCGAGGACGACTCTGTCCATGCCATTTTGCGCAACACAAAAAAGCAGAACGAAGCTGAAAAATGCGGAAGT
TCAAGCTCGAGTTGCCACAGTTATACCCTGTGCAATACCCTTCTAATGCTGCGCAACTGTCGCAGTGTTACGAAA
GATCCCAGAGCCCCTCTTGTGCAACCGGCCTTGGCAATTCCCTTGCCCGAAAAGTGCCGCGTCAGGCTGCACGTC
AAAGTCCTGCAGAAGGATGTCGGTATCTTCTTCGAATGGTGGAACAATGATATGTCCACTGAGCATATGAAGAGC
GTCGCCGACTACTTCGAGCAGATACTTTCACGCATACTCTCGGCAGAAGATACTGCCGCGAGGGACCTGAACCAT
TTCTCAGATCGAGATTGGTCCAGAGTCTGCAATTTCAACTCTACCATCCCCCAGGCACATGACCGCTGTATACAC
GAGGTCATTCATGAGCAAGTCCTGGCTCGCCCCGGAAGTGAAGCAGTTTGTGCGTGGGATGGAAGTTTGACCTAC
CAAGATCTGGATCTCCTGTCATCCCAAGTTGCTTATCACCTTCAAGCACACGGAGTCGGCCCTGAAAAATGTGTC
GCTCTGTGTTTCAACAAATCAAAATGGAATGTAGTGGCAATGCTGGGTGTTCTGAAAGCTGGCGGTGCTTTCGTC
CCCCTTGATCCAACACATCCAACCTCTCGTTTACAGTCGCTGGTGCACGCTGTGCAAGCCAAGGTCATGCTTTGC
TCCAGAGACCGAATAGGAGAATTGACTGGGGTAGCGGAGATGATAATACCACTGGACCAGGCTATCATAGACGAA
ATCTCCCTTCAAGCTGAAGAAATCTACTCATTGCCGGATGTACAAGGTCACAATGCAGCCTACGTGATATTCACT
TCTGGATCAACAGGAGAACCTAAGGGTACCATGCTAGAGCACAGAGCCTATGTATCCGGAGCCGCTGCCCATGCT
GGACCGCACCATATGTTTTCGACTTCACGCGTCTTGCAGTTTGCGGCACACACGTTTGATGCCAGTCTTGTCGAG
ATCTTGACTACCTTGTTGCAAGGCGGCTGTGTCTGCATTCCAAGTGAAGAAGAACGCTTGAGTGACATAGTCAAG
GTCATCAACGAGATGAACATAAACCATGCTATTTTGACCCCATCCTTTGTTGAGTTCATTGATTCCTCGCAAGTC
CCAGGTCTTGAGACCTTGATTCTTGCTGGAGAGGCGATGTCACAAGGCCAGCTGGAAACATGGTCGTCCGCCCTC
CACCTCATCAACGCCTATGGCCCCACAGAAAGCTCTGTTGCTGCCGTTGTTAACGCCAAAGTTACACCATCTTCT
GATTGTCGGGATATTGGACTCCCCGTGGGCAAGACAAGTGAAGCGTTCATCCATGATCCAGCCTGGATGAGAAGG
GACGGATTAAATGACTGTAACCGGAGAGTGTACAAGACGGGTGATCTGGTGAAGTTTCATGGACAGAGACTTGAG
TTGGGCGAGATAGAAAACCAGCTGGCTGCCGACCCAATTGTCAAACACTGTCTAGCTTTTCTTTCGAAGTCAGGG
TTCTCTGCAGGCAAATTGGTGGCGGTAATATCCTTATCTGTTCACTTCGAATCTCAACCGGAATCAAATGCAGCG
CCACTCAAGCTCCTTGATACATCGAAGAAGACCTCTATCGTTGCAGAAGTTCGCGAGAGATTATCAGCTAAACTA
CCAACCTACATGATACCCTCCGTTTGGCTGTGTGTGGAGGCATTGCCGTTGCTTCCGTCTGGGAAGCTGGACAGA
AAGGCGACCGCAAGATGGATTGGAGATATGGAGCGAGACCCGTATGCCCAAGCTATAAGCGCCAGGACTTTGTCT
GCGGATAAAGCCACACTTCCTTCGAGTGCCACGGAGGACAAACTCGCTGCGATCTGGAGCCGGGTTCTCAATATC
CCCCGAAGCCAACTTGCCCTTGACGAAGGCTTTTTGAGTCTAGGTGGAGACTCTATTGCCGCCATAACGTGCCTC
GGGTATTGCAAGAAGCAAGGAATGGGCTTGACGGTACAAGAGGTGCTTCATAGCAAGTCAATCAAGGAGCTGGCT
ACTCGGGTAAAACAGATCGATCAATTTGTTGTGTACGAAGAAAAGATCGATGAGCCCTTTGACCTTTCACCAATC
CAGAAGCTTCACTTCATGGTCCGAAACGAGGGCCAAGGCCACTTCAACCAAAGCATTCTTACACGCCTGAACCGG
CACATTGATGAGCATAGCATGCGACGTGCAATTGAGACCATTATCAATCGTCACTCTATGCTCCGCGCTCGCCTG
GTCGAATCAGACGTTGAGGGGATAATGCGGCAAAGAATAACTCAAGACGTAGCAGGGTCTTACCGTTGGCGTTCT
CACAACAACAGCAACCGAAGCGAGGTCGACCATGCTATCTCGAACAGCCAGTCATGCATCAATGCCTTCGTTGGC
CCCGTACTTGCAATAGATGTCTTCTATGGAAATGACCATTCCCGCCTGCTGTCACTCGTGGCTCATCATATGGTA
GTCGACATTGTTTCGTGGAGGATTATTTTGGAAGACTTGGAAGACCTACTGATGAACCCCGATCAACCGATATCA
CAGAACGGCTCCCTTCCGTTTCAGAACTGGTGCCAAATTCAAGCAGATCGTTGTCAAGAAGCGACAGCTGAACGA
ACCATGGATCTGCCTGAAGTTCCCGCACCCGATTTTGCCTACTGGGGACTAAAAAGCCACCAAACCACCTATGGC
GATGTGGATTGTGAAACGTTCGATCTTGACAGTGATATTACTCGCCACATACTGACTGGGTGCCACGAAAGTCTT
CAAACAGAGCCAATCGATCTTTTTCTAGCAGCTTTGCTACACTCCTTCGGCGAAACGTTCAAAGACCGATCATTG
CCAGTTATATACAATGAGGGACATGGGCGAGAAGTCTGGGACTCATCAATAGATATCTCTCGCACTATCGGCTGG
TTTACCACACTGTATCCCATTCTTCTATCGGAACTTCCTGCAAAAGATCCAACCGAAACGGTTGTACGTGTTAAG
GATTTGCGACGTTGTGTTCCGGACAATGGTCGACATGATTTCGCTCGTCGTATGTTGGTTCCACGCGAAGATGGG
ACTTGTCGGCACTATAGCCCCATGGAGATGTCTTTCAACTATGTGGGCCAGCACCGTGACCTACAGAGAAAGGAT
GGGCTCTTCCAACTCATGGATCAGATGGCTGGAGAAACAGGCCGCGGAGGTGCAGCGGCTGATTTTGGTGAAGAA
ACTCCTCGCTTTGCACTGTTCGAGATATCTGCGATGGTTGTGCAGGGTCAACTTCGCTTTATCTTCTCCTTCAAT
AGGAATATGCAGCATCAGAATGGTATCCGTAACTGGGTACACTGCTGCAAAACATTACTGGCATCCCTGGGCGAA
CGCTTACAGGCTCTCCCACCGAAACCAACGCTAAGCAGTTTCCCCATGTTAACATTGACATATACCGAACTCGAT
GCGTTGGTGTCGAAAAAATTACCGGATGCCGGTATTCATAGTCTTGATGATGTTGAGGACATCTATCCTTGCTCC
AGAATGCAGCAGGGCATTCTACTCAGTCGCTCTCGCGATAGCTCACTTTATGCTGTACATGACACATTCGAAATA
TCCGGGCCAGGAAGCACACCCGACATCAACCGATTGATACTTGCCTGGCAGAAAGTCGTTGCTCACCATGCAATG
CTACGGACTATATTTCTGGAGGGGTTGAGCAGCCACGACCTACATTGTCAAGTGGTGCTCAAATCGTTCGATTCC
CGCCCAACTTACGTCGTATGTGCGAATGAAAGCGAAGTGCTACCTACATTTGACAAACAGCAACCGATGAGCTAC
GATAATAATATACCTCCTCATCGGCTTACAATCTGCCAAACGGCTTCTGGGAAGCTGTTTTGTCGACTGGAGCTG
AACCATGTCGCCATGGATGGCGCATCAATCTCCATCATCCTTCGGGATCTGCAATTAGCGTACCAAGGAAAGCTC
GAAGAACCAAAGCCGAAGTTCAAAGAGTATATACGCTACCTTCGTGAGGTTCCCCAAGTCGCAAGTCTTGACTAT
TGGCGCAATTATTTGTTGGATGTCCAACCTTGTCATTTCCCCGTGCTCAATGACGGCAAAGGCTCTGTAAGGCAG
CTTCGGACCAAGAGATTGGGCGGTGTGCCATTCAAAGAGCTACGAACCATCTGCGATATGAATGGTCTGACCCTT
CCGACTGCCTTTAGTGCTGCATGGGGATTAACGGTTCGCTCCTTTTGTGGATCAGATGACATCTCCTTCACCTAT
CTTGCATCACTAAGAGATGTCCCAGTAGAGGGCGTTGAATATGTTGTTGGACCTGTCATCAATACCCTGACCTGT
CGTATGCTGTTTGCTAAAGGGACGTCACTGAAGGAGATCCTCGCAAAAGTTCAACAGGATAACCTGGACAATTTG
CCGCACAGGCATATCTCACTCACGGAGATCCAGCAAGCTTTGGGACTAACAGCCTCATTGGCTAATAGTGGTATT
TCTTACCGGAAGCTTCCCAATCAGAATGCTTTGTCAAGCGAGGAGATACAGTTCTCTGAAGTGGGGACAATTCAC
GACCCGGCAGAGTCGCCCGTTTTTGTCAATGTTGAAGCTACAGAAGACGACGCACGTATCGACCTTAACTACTGG
ACAGACCACCTGTCGGACGGGCAAGCAGAGAATGTCGCGAGCACATTCCTTAAATCGGTTGAAAATATTGTGCAC
CACTTTGAGGATGACGCCCATTCAATTGACAACTTTAGCGACGCGAACAGACAAAGCCTAATGCTTTGGAATAGC
GAAGTCCCAAAGTCCATCGACAAATGCATGCATGAGATAGTTGATGAGTGTGCGAAATCCCACCCTCACACCATG
GCAATTTCTGCTTGGGATGGAAACCTCACTTATGCTAAGCTCAATGAATTGTCATCGCTACTTGCAACGTACTTG
ACAACACTAGGGGTGGGCCCCGGAACAATCGTGCCCCTTGATCTCGCTAGATCCTCCTGGCAAGTTGTAGCCATC
TTGGCAGTCATGAAGACAGGTGGTGTATGTGTTCCGGTGAACCCAGCCCGACTGCCACAACATTTCGAGACTTGG
CTCGTCGACAATGAGATCCAGGTTGCCCTAGCATCACCGACTCAAATGCAACTACTCGAAGGGGCCGTTCCATAT
GTAATTTCCGTGGAGAGCTCTCTGTTTGAATACCTTTCAGACAGTGATGCAGTTTCAAGCTCACCAATTCAGCCA
TGCAGCGATGCATATATCGTGTTCGGCGCTGAGAGTCCCAAGTGCATCTTGATTGACCATCGTGCAATAACAACC
CGGGCAAGCGCGTTCGCTTCAGGTCTTGGACTAAATGCACGAACAAAGATGCTCCAATACGCTCCATATACTTCT
GACATGTTCCTTCAAGAAGTCTTCGGCACGTTCCTGTGCGGTGGGTCTATCTGCATTCCGTCAGATGAAGACCTG
GCAGACCTGTCAAAAACCATCAAGACAATGCAGGCGAACTGTGTCAGTATCACACCCTCAACGGCGATGACTCTA
AGATCCGCAGAGGATCTGGGGATAGAGGTCCTTGCTTTATGGGGTGAACACCCGACCAAGCAACTTCTTACCGCC
TTGCCTGGAGGAATCCAAGTGCATGCATTCTATGGAACGCCAGAATGCTCATCTTCTTGCATTCGATCCTCTCAG
CTTGACGGATCATGCGAATCGTCAATTATTGGGTCAAGTCTTGGATGTAAATCTTGGCTTGTAGATCCCTCCGAT
CACGATATTTTGGTTCCGATCGGCTGCGTTGGCGAACTGATGATAGAAGGCCCAAGTCTTTCTCATGGTTACTAT
CAAGATGCGGAACTCACGCAACAATATTTCGTCGAAAATCCCTTGTGGAGACTGGCTTACGAATCCCAGCCATCA
TCAGACAAAGACAAGAACACGGACGCCCAGAAGCTGTCCTATCGATTGTTCAAGACTGGAGATCTTGCTCGCTAC
AACTCCGATGGCACACTCGTTTACGTTGGTAAGAAAAATAGAGGGTTGCATTGGCAGCGACAGACAGCGGCCATT
TACGTCGAAGAGCAAATCGCATCTCTCTCATCCTTCAATGCCCAGTATGTCGTTGAGGAGATCAGCAAGAGCAAT
GTCGATTCTCCCCGATCGTCTCTGGCCATCTTTTTCTCTGATGAGGCCGTCGACTCCAAGGGACACCACCAGCCT
ATTGCACAATTGTCACCTGAGCTGCACGACACAATGATCAGGCTGTATAAAAAGCTGTCGAGCTCCTTGCCAGCG
AATTCTGTCCCGAGACTGTATTTTCCGACGTCTAGCATACCACTGAACTCGTTCGGTAAGCTGGACCGCCAGCTG
CTGAGAAATGCGGCTCAAAATCTGCCAGAAGAATTGCTGTCTAGATTCGACATCAAAAGCTTTGACAGCTTCTGG
AAAGGGCAGCTGGCCACATTGGCGCTTTCGCCAGTGTTCCCGTCACCCCGTGGCTCTTCGTCTCAGCGGAGCACA
CCGGTCACCAAGCAAGCAACAAAAAACATGCAGATGGTCTGGTGTGATACACTCAGATCAATGACCGAAGGTACA
CGATGTGCTATCCTTTCTGCATGGGCTCTTACTATTCGCGGCTACATCAGCTCCCGTGATATTGTTTTTGGGGAG
TTGCTGTCAGAAGTTGAATTGGCCTCCACTGAGCGTCAGGACAATTATACGCAAGCTGCAACTATCGTTCCCCGA
CGCTTCCAACTCAACGATGATTGGACCATTACTGAGTTACTGAGCAGGGTAAAGTATCAACTGGAGTCAGCTAAG
CCCTACCAATGGGCTGGAATAAGTCAAATTCAGAAATTGAACGCTGATACGGCGCGCGCCTGTGATTTCATGAAC
TTGATCTCTATAACGGACAATCGTGGCCTTGAACCAAGACTAGTACCCATGAAACAGCATGACAGCAATCTTTCC
GGTTATCCTTTGATGGTTGATTGTATCCTTGGAGATGCTACGCTCGAACTCTTGATTAGTTACAATGACAGCACT
TTAACAGGCACCCAGATCGAGCGACTGGCTGCCCAATTCTTCGCTTGTGTTGGACTTCTTAACTCCAAGGCTAGC
ATGAACAAGACAATCGGTGTCTTGTCCAGAGACAACATGGACTTTTGCTCCTTCCGCCATGATGTTGCCTACTGG
AAAAACTATTTGGAGGATGTTGAAGCTTGTCTTTTCCCGGCACTACGTGCAAGTGCGGAGGAAAATACTCATGCT
GAGACCCAGATAATACTCCAGAACACCAAGCATCTACATGATCTCAGTGAACGTGAACGTCTCAGCAAAAGCTCG
CTTCTTCAGCTTGTTTGGGGCTTGGTTCTGCGATGCTACACAGGCCTACAAGATGTGTGCTTCGGATATCACATT
CCAGATGCAAGCGACAGATCTGCCAAGCCTGGAGTTGCGAATAAGCCAGATATTTCAGGTACATTCCCGTGCAGA
ATGCTCTTGAATGGTGAATCTAGGGTTGCGGAAATTTTGAGAGAGCGACTGCAAGGACTGAATCAAATGCAGCAG
CATCGGTTGCCGTGGGATGAAGTCCAGCAAGAGCTTGGGTGTAGCGACATTTTCAATACCGTTTTCACTTGTTCA
GAACAATCAAGTGACGCAGTAAATGTGGCTGGTCTCGCTGATCTTGATCCGAGCAAATACCTGATTACCGTCAAC
GCCACTCTAGCAGAATCATCAGGAGTCATTAGGTTCGGCTATCAAAGGAGGCACTTCTCAGAAACCGACATGGAA
GGCGTCCTTGATTGTTTTAATAATATTCTGGGACAGTTACTCCAATTCCCTCTTCCGGATCTTTTGGTAGGCGAG
GTTGACTTTGTGAGTGAGCTTTCCTGCCAGAAGATATCTGAGTGGAACTCGGCGCTGCCAGACCGTCCAGTGCTA
TGCGCGCATGAGCTCATCCAACAGCAAGCTTTGGATCGTGCTTCGGCTCCTGCAATTTGTTCTTGGGATGGCAAC
TTCACATATGCACAACTTGACCGATTGTCGACTCTCCTAGCAAACCAGCTGGTGGGCTTAGGGGTCAAGCCCGAC
ATCTTCGTTGCATTGTGTTTTGAAAAGTCCGCATGGGCGGTTGTTGCACAGGTTGCTGTTTTGAAAGCTGGAGGA
GCCTTCGCTTCATTAGATCCAGCTCACCCAGAAAGCCGCCTACAAGGCATGATCGATGATCTTGGCGCTCAGGTT
ATTCTTTGTTCTGAGACACACTACGAGAGAGCCTCCAGCATCTGTCGTCGCGCAATGATCGTAAGCAATAGCGCA
CTTGAACAACTTCACCACTCACCCTTTGCTGCTCCGACCCAAGAGGTAACCGCTGATAACGCAGCCTACGCCATA
TTCACATCGGGAACCACAGGGAAACCCAAGGTGACAGTACTTGAGCATGTTGGACTTACCCTAGCCTGCACAGAG
CTCTCCAGGGCCTTCTTCATAAGTTCAGAAACACGCGCTCTGCAGTTCTCAAGCTATACATTCGACGTCAGCATA
TTGGAAACTATAATAGTCCTTGCTGCTGGTGGCTGCATTTGTATCCCTAGCGAAGATGAGCGCATGAACAATCTT
TCTGGAGCCATCAGAAAGATGAACGTCAACTTCATGAGCTGTACTCCATCTATCGTTAATACCATGGACCCCAAT
GCTGTTCCTTCATTGCGAACAATAACTCTCGGAGGAGAAAAAATGACTGCAAGCCATTTCGAGCGATGGGCTGAC
AGGTGTGTTATTAACGCGTACGGTCCGTCAGAGGCTACTGTCGCCTTTACGTCAAGCACGAAATACGACCATGCA
GGAGTACGCCTTACTGATGACTATGGTTCTATTGGCACTGCTATTTGTGGCAGGACATGGATTGTTGATCCCCAA
AATCACAATCGACTTGTGCCCATCGGCGCACCCGGAGAGCTCGTTCTTGAGAGTTGCACTGTTGCTCGTGGGTAT
CTCAATAATGACGAGAAAACCAAGGCTGTTTTCATCCGGGACCCGGAGTGGACTCAGCGTGAAGGGCTACAGCAT
GTGTTGAGGCGCAAAGAACGGATGTATCGCACGGGAGATTTAGTGCGCTACAACTCCGACGGCTCGATTGCTTTC
ATTTCGCGAATTGATACACAAGTGAAATTGAACGGTGTGCGCATCGAATTGGAAGAAGTTGAGCAACAATGCAAC
AACTATCTTTCGACAGATACTCAGGTTGCCGTTGAGGTTGTTACTCCAGAGGCCAAAACTATATCAAAATGCTTG
GCTGTCTTCTTCACCATTGACGAGCATCAAATGAAAGATATGGCGAATGGTGAATTCATTTTGCCCATGTCAGAG
TCTGTAGTTCACATGGTCAAGAAGCTACACGGTTCCCTAAGCGCTTCATTACCGCTAGCTATGGTGCCCAAGCTT
TACTTCCCCATGCGGCGCCTGCCGTTTGGAAGCACTGGCAAAACTGATCGCAAAGCACTTCGAGCAATGGTCGAT
ACATTTACCAAGGAACGCTTGAGACCATATGTTATCTTCAATGTTGGCGCAGAAGAACGCTCCGATGTGGGAACG
GAAGGGACAGATAGCGTTCTCAAGACGCTATGGGAGGAAGTCCTTAACCTTGCGCCAGGTTCTATCAGTGCCGAA
GACAACTTCTTCGGCATGGGTGGCGACTCGTTTTCTGCTATGAAATTAGTCGTAGCCGCGGCATCCCAGAATATT
TCACTTGCAGTGGCCGACATATACCGAACTCCTATTTTCAAAGACATGGCAAAGAGATGTGGAGCGGGTGAGGTT
AAGACTGGTGTACCAACAGTGGACCCTTTCAGCATGCTGCCTGAATCTCTTCCACGCGATGATATTCTGGAGGAA
GTCTCTGACCAATGTGGTGTGCCTATGGATCGAATTGCGGACATCTACCCGTGTAGTCCGGTGCAAGAGGGTTTG
CTCACACTTTCTATCAAGCAACCCGGAGCCTATGTCGCTCGACCTGTGTTCCAACTCGCAGAGGGAGCTGACCTT
GACAAGTTTAAAGCTGCTTGGCAAAAGGTGGTTAATGAAATGGATATTCTTCGGACTCGGGTAGTACACACCGAG
TCCGCCAACTTTGTCCAGGCAGTGCTCACTGATGTCCCTATCCTCTGGGAAACGGCAACGGAATTGGACGATTTA
GCAAACGACACTATTGACCTAGCCAAGAATAACGGGGGCTTGCTAACTGGATACGCCATTGTCGAGTCCGGACAC
TCGCGCTCCTTCGTTTGGACCATACACCACGCTCTCTATGATGGATGGAGTGTGTCCCAGATCCTTCAAAGAGTT
GAGGAGATATACTCGGGTGCTTCAAAACTTAGCTCGACGCTTCCTTATAAGCTCTTTATCAATCACCTGGTCCAG
CAAGAGGCTCATTCCTCGGACGAATTCTGGAAGACGCACCTCGCGGCCCTGTCTTCATGTCCTTTCCCCCAGAAC
AAGCCGTCACCTGATACCATTCGCGTCGGCAATCGGCATTACAGCTCGCTTGAGATTTCTCGTGCATCAAGTGGG
CCTAAGTTAACCGTTCCTGAAATGATACGAGCTGCATGGGCACTAATTGTATCCGTCCACACCGGTTCCGGAGAT
GTCTGCTTCGCTGAAACCCTAATGGGTAGAAATATTGATATGCCTGGGGCTATGGAAGTTGCAGGACCTCTTTTG
ACCACGGTTCCTATACGGATGGCTGTCAACAACGAGCTCTCGATTATCCAGTACCTCGATAATGTGCGCCAGCTG
ACCACAATGATGCTCCCGCATCAACATTCTGGGCTCCAGAGGATCCGCAAGCTAAGCAGCGACACTGCCCTTGCT
TGCGAATCCCAAAATCTACTGGTTATTCAATCAGAACAGGCCCATTCGAACACAAGTATCTGGGAGCAAAAGGAT
AACCTGACTGAAGGCGAATTTTTCACCCACCCAATTGTTGTCGAATGCAAGGTTGGCGAATCGCAGGTGGCCGTA
ACCCTTCATCACGATGAGCTTGTTTTCGACAGTTGGCAGGCTAAGATGCTCATTGAACAGTTTACCTTCGTTTTG
AGTCAACTGTTATCAATCTCCAATGAAGAATCCAGAAAGATCGGAGAGCTAGAGGTTTCCAGTTCTCGGGATAAG
GAAGAAATTGCTCTCTGGAATGAGAGAAACCTGACTTGCATAGACAGATGTGTTCATCATATCATTGAGGAGAAA
GCATCCCTCCGACCTCAAGCTCAAGCCGTCTGCTCCTGGGATGGACAACTAACTTACCAGGAGCTTTACCAGCTT
GCTTCTTCGTTTGCAGCTTACCTGAAAACTCGTGGCGTAGGTCCGGAGACTTTGGTTCCGATCTGTATGGACAAG
TCTTTGTGGGCCATTGTCACAATACTGGGTGTCCTCATTGCGGGTGGAGGATATGTCCCCCTTGACCCTGCTCAC
CCAACGTCAAGACACAAGGAAATTCTGACTGAGGTCGAAGCCCGTGTCGTTCTCTGTTCTCCCAAGTATCAAAGT
CGGTACACTGGCTCTGTGAAAGCAATCATCCCTGTCAGCAAAGAGACGATCAAGGCGTATTGTGCTCTTAGAACG
GCAACTGCTAAGACTACTAACAACGCTACACCCGAAAACGTTGCATTCGCTATCTTTACCTCTGGCAGCACTGGT
CGTGCTAAGGGTATTATCATCAACCACAAGGCACTTGCCAGCAGCGGCATGGCATTCGGGCCCATGGTGCACCTT
GACGAGAATTCTCGAGCTTTCCAATTTGCCTCTCTTACTTTCGATGCTGCTGTCATGGAAACACTCGTCACCTTG
ATGCACGGCGGTTGCGTGTGCATTCCAAGCGAAGATGAACGCTTGAATGATGTTGCTGGCGCTATTCGTCGGATG
AATGTCTCTTGGTCATTCCTGACTCCATCCATAGCCAGTATCATTGAACCGTCATCCGTTCCATCTCTGAGGGAC
CTTGTGTGTGGTGGAGAGAAGATGTCTCGCGAAGTCATCACCAAATGGGCACATCGGGTAAACCTGATGAATGGA
TATGGTCCAACTGAAACTACTATCTTCGCGGTTATCAACACAGATGTTGCTGCCAACCCGGATCCCGCCTGCATC
GGCCATGGCATTCCTTGCACCCTAACCTGGGTTGTCGATCCTGATGACCACAACAAACTAACTCCTCTAGGGGCT
GTTGGTGAGCTGGCACTGGAAGGCCCCGCACTTGCTAGGGAATACCTCAAGAACCCTAAGAAGACAGCAGAGGCT
TTTGTGGATGAGCCGGAGTGGATTAAGGCCTTCCCTAGTGTCCTACCTTCGCCCAGAAGAATATACAAGACTGGA
GATCTTGTCAGATACAACTCTGACGGTTCCATTCAATACATCAGCCGCAAGGACCATCAAGTCAAGCTTCACGGG
CAGCGCATGGAGCTTGGAGAGATTGAGCACAGACTATATGAGGACCCGCGAGTCCGCCACGCTGTGGTCTTACTG
CCAACGGCAGGTCCCCTCAAACAGAGGTTGGTCACTGTTCTTTCACTGAATTCTGTAACTGCGGAGAAAAGCATC
ATATCAGACAATGCATGTGAACTTGTCGATCGGGGTGGATCTGCACGGGCAGCATACCAGGAGCTCGTTGCTATC
CAGAAGAGCTTAGAGACACAGCTACCAATCTATATGGTTCCACAGGCTTGGGCTCTGATCAAGCAGCTCCCAATG
CTCGTGTCTGGCAAGCTAGACAGGAAGCGAATCACAGCTTGGCTGGAGAACGTTGATGATGCTGCTTATGATCGC
ATAATGGAGGATTACGACAACATAAAACGTGGGGATGTCGAGCAAGACGAGGAGAAAGAGGATGACCGAGAGACT
TCTGTCAAGCTTCTTCAGGAAGTCTTTTCCCAGGTTCTCAACTTACCATCTCACAAGGTGGGCTTGGACAAGTCA
TTTGTGAGCCTAGGTGGTGATAGTATCACTGGAATGGCTGTCATTTCTCGAGCGCGTAAACATGGACTCACGCTG
ACCCTCCACAATGTGCTTCAGTCGAAGTCGATAAAGGAGCTTTCTCTAGCTGCTCAGACAAGCGTCAAGACAGTG
AAAAGAGAGGAGAAGCCTCATGAATACTTCGAACTGTCTCCGATCCAGGGATTGTTCGTTCAAACAACAACAAAT
TTTCGGGATTCTTCTCGCTTTAACCAAAGCATGACAGTTCGCGTTACTCGAAGGGTCGAGCCAACTAGAATGCAA
AGCGCCATTAAGGCTGTTGTTGAACAGCACTCCATGTTCCGAGCACGGTTCTTCAAGTCTCGCGACGGAAAGTGG
AAGCAGAAGATCAGTGATGATGTTGATGCCTCATACCGCTTCCGTCATCATATGGTGGAAAATAAAGATGCAATT
CTCCCCAAGATCGCCGAGTGTCAACGGTCTGTAGATGCTCAACATGGACCCATCGTTGCTGCAGACATGGTCCAA
GTACGCAACGGCATCACAATACTTTTCCTAGTGGCCAGTCATCTATGTGTTGACATGGTATCCTGGCGTATTGTC
CTCCAGGACATCCAAGATTTCCTCGATGCTGGATCATTGTGCCCAGAGAAGCCCCTGTCATTCCAAGCTTGGTGC
AACCTTCAGCTTGAACAGAGCAAGAAACCAAATGGCAGAGTCCAGCTGCCTTTTTCTATTCAGCCTCCTGACCTG
AAATACTGGGGCATGGAGCAGTCCCAGAATCTCTATGGGGATGTCAAGATGGAAGGGTTCACGCTTGATGCCGCA
GTCACGACACAAATCCTCGCAGCCTGCAATAAGGTTCTACGCACCGAGGCTATTGAAGTCATACTCTCCGCTGTT
ATTCACTCTTTCCGTCGCACGTTTACTGATAGAGAAATGCCGACTATTTACAACGAGGGCCACGGTCGCGAGGCG
TGGGACAGCTCTATCGATCTCTCAAGAACGGTGGGCTGGTTCACGACTATGTGTCCACTGCATGTTGGTGAAGGG
TCGGATCTACTTGACACTTTGAAGCGTGTCAAAGACACAAGGCGTCACCTCAGCAGTAAGAGCCGGTCATACTTT
GCGGAAAGCCTGCTTCAGCCGGAAGGTAAAGAGGGCGATGCTTTCCCTGTCCCGCTCGAGATTCTGTTCAACTAC
CTTGGCCAGCTGCAACAGCTAGAGCGCGATGATTCGCTTTTCCAACATTATGGTGAAGCCTTCAACGCGGAGACC
TTCGAGATGACAGGGGACATGGGCTCAAAGACACCTCGGTTTGCTCTCTTCGAGATCTCGGCGCTTATTATCAAG
AACAAGCTTCAGGTATCGTTCACTTACAATAAGCACATGCAGAAAGAACAGCGGATCAAGGGCTGGATATCTGAG
TGTAAACGAGTGCTGGAGCATATGTCTCGTTTCGAGAGCTTCACGTCTGAGCCGACACTCAGCGATTGTCCCTTG
CTCCCCATCACTTACGAAGGCCTGAACAACATGGTCAAGAGAGCATTCCCCAAGATCGGAATTGATAGCTGGGAT
CAGGTTGAGGAGGTTTATCCCTGCTCCCCAGTACAAGAAGGTATCCTTCTTAGTCAGCTTCGAGACCCGGAGGAA
TACCTGTTCCATGTCATCTTCGAAGTGCACCCATCCAAGGGTAGCAAGGTGGATACAAGCAAGCTTCGAAAGGCA
TGGTCCATGGTTGTCAGCAGGCACCCTATCTTACGGTCTGTCTTCATTGACAGCAACTACAAAGGCGGATCTTTC
GACCAGGTAGTGGTCAAGTCACTCGACGATGAGGTCATTGAGTTCCAGTGCCCTGAGTCGGATGCATTGGGTACA
CTTGGGGAAATAAAGCTGCGCGATATCAATGCTGAGAGATCGATGAAGCTCGCCCACCAGATGACCCTCTGCAAA
ACAACTTCTGGGCGAGTCCTGTTCAAGATTGAGATGAACCATGCCATTATCGATGGCGGGTCGGTTGACCTGCTT
CTTCGGGATCTCGCCCTCGCATACAGTGATCAGCTTTCTGCCGGAACCGGTCCACGCTTTAGTGATTATGTCAAG
TATATCAGGGAACAATCCCAGGGAGAAGCTGTGGCACACTGGGTGAAGTATCTCTCTGGCGTACGACCTTGTCAC
CTCCTGGTATCTTCCAAAAAGAGCGGTAGCCACCAGCTCGGCGAGCGCATGATATCTTTCAAGCGCTTTTCTGAG
TTGCAAAGATTCTGCGAGGAAAATTCCGTCACACTCGCCAACTTGACCCTCTGTGCCTGGGCAATTGTACTCCGG
AATTGTACAGGATCTGATGATGTCTGCTTCGGATATCCGTCTGCTGGTCGTGACTCCCCTGTTCCTGGGATCCAA
GATGCGGTCGGTATCTTCATCAACATGTTGTGCTGTAGAGTCAAGTTCTCTCCCGGACAAACACTTCTTGAGATT
GCCAAGAAGGTACAGGATGACTTTGTCAGGAATGTGCCGCATCAGCACTGCTCTCTGGCTCAGATCCAGCATGAG
CTTGGAATGCATGGAGAGACGCTCTTCAACTCAACTCTTTCCATTCAGAGTCGCTCTGCCAACAAAGGCACTGGA
AATTTGCCGCTCGACTTCGACGCCCAAAAGGCCCATGACCCAACTGAGTATCCTGTTACTGTAAATGTGGAGACT
ACCAAGGGCAAGGAGGGAGTTTTGCTGAGGTACTGGAGCAACGCAGTGACCGAAGCACAAGCAAAGGAGCTAGCG
GAAGCTGTTACCAAGGTCTTCACATGCTTCATCGAGGAGCCATCCAAGCCGGTATCGAGCTTGAACCTCCTTAAC
AAGCTACCGCGGAACCGTTCGCAGCACACCCACAGAGAGCCCCTCATTTTGGACCAATTGATTGACAGTCAGGTC
CTACAGAAGCTAATTGACGATCGCGTGAATGAGATAATCAGCCAGATGCTGAAGGAAGGCAAGCTCGCCATACCC
CTTCCTGATCAGAAGACTAGATACTCGAACAGCTCTGTTCAACTCAAGATGGTCGAGGCTTCGCTCCAGAAGGAT
CCCATAATAGACGAAAAGGATCTTGCAAACTCAACACCATCCCTAACAGATGATGGCAGAAGCTCAAGTGACAAT
GATAGGCGCCTTTGGGACCTGTGGAAGTCGACATTAGGGCTATCTTCAGACACTATCCAATACCGGAGTAGCTTT
TTCAAGCTAGGCGGTGATAGTATTACAGCAATGAAGATGGTCAGCGCTGCACGAGAAGAGGGCTTGCAAATGACA
GTGGCGGATGTGTTCAACAACCCGATCTTCGAGGACATGCTGGCTACGATTACTCCGAGCAGCAGCCCGACCTCA
AACGCCGATACCCAGTGCGCAAACAACATTGAAAAACTCCTGGAGGTTGATGATGCTCTCCCAGATGCTACCCCA
CCGCAGGATATCTCGGTGCTTAGGCCAATGCAGCTCGATGCCATGTCTCTGCTTGATGTCATCTGCCCTAAGATA
GGGGTGTTCAAAGGAGGAATTGCTGATGTTCTCCCTGTTACGGACTTCCAATCCATGTCGATCGCTGCCACGCTC
TTCGGATCGAGGTGGATGCTGAACTATTTCTTCCTCGATGGAAGTGGTCCTCTAGACCTTCGACGACTGAGGGAA
AGCTTCTTGAGGGTGGTCGATGCTTTCGATATCCTTCGGACTGTTTTTGTCTGCCACCACGGGCAGTTCTTCCAG
GTGGTGCTGAGAAAAGTCCGACCGGATATTTTTGTGCATGAGACGGAGCAGAGTCTAGATGAGTACACCAACGGC
TTACAAAAACGGGACCGTGAACAAGATCCACGCCAAGGTGAGCAGTATGTGCAGTTCTACGTTGTCAAGAAAAAG
AATAGCGACCAGCATCGCATCTTGATCAGGATGTCGCATGCCCAATTCGACGGCGTTTGTCTGCCAAAAATTATG
AACGCAATCAAGCTGGGATACGAGGGCAGCACCCTACCTCCAGTCTTCTCCTTTTCGAACTATATGCGGATGCTT
CCTGGAAACATCACCCCGGCACACTACCACCACTGGTCAACAATACTCAAGGGCTCTAAGATGACCGATATCATT
CGGCGCACGCAGCCTAATACCTTCATGCATATTGGTGCTTTCGCTGAGCAGAAGAAGACGATAATGATACCCTCA
ACCGCCATAGGAAATGTCACCCTCGCGACCGTTATGCAGTCCGCATGGGCGGTGACTTTGGCAAAACTGACTGCC
CAGTCGGACGTGGTCTTCGGGCTTACAGTCAACGGCCGTAACGCCAGTGTTCCTGGTATTGAGACCACTGTTGGG
CCCTGTCTTAACATTCTTCCCATTAGGGTTAAATTCAGGGAGCATTGGACTGGCCTTGACCTCTTCCGTTATCTC
CAAGATCAACAGATCGCCAACATGCCCTATGAGTCGCTAGGATTCAGGGAGATTATCCGGAACTGCACCGATTGG
CCCGACTCCACATACTTCACCACCTCCGTGTTTCATCAGAATGTCGAGTATGAGGGACAGATGCATCTAGACGGC
AATTCGTACCGGATGGGAGGCGTTGGTGTTTTGGACAACTTCACTGATCTCACGCTGGCCTCCAAGTCCTGTGGT
CAAGAGAAGCTCGATGTCTCAATCGGGTACTCGCTCAAGGGCCCCATTCCAGCAACCTTCATCGCTAAAGCCCTT
AACATGGTTTGCGAGACTGTGCAGAGCCTGATTGCCAACCCCAGCGTCCCACTTGCGTCCCCTGCCACTATCCGC
TCCCTGCCTAGCCAGATCATTCGTGAAACACCCAGAGCATCTGATACACCCTTCCTCTCGTCAAATCTAAACAGC
CAGAAGATGTCGGAGATTGTAATTCACTCAGATATCCTTACCCGGTCCTGGCAGCAGGTGCTACCCCGTCAGACT
GACAACCCACAATACCAACTCGATGCATCTTTCTTCGACCTGGGCGGAGACATCATGAATGTTGCCCAACTGGTC
TGGATTCTGGGAGAAGAAGGCTTCAGTGTCCGTTTGGAAGACCTTCTCGAGCACCATACGTTCCTGGGAATGATG
GCCGTGATGGCGATGCACCACAAGCCGGAACTGAATGCCAGAATGGCAGCGACCATGGCTGAAGAACCAGCCAAG
GAAATGAGAATGACTATGACAAAGAGCAACAGCTGGAGCTCGCTGGGCAAAGCGATGACGCTTGCTAAGAGATTT
ACTAGATGGGGGGCTGTAGCAGCCAAAAAGTGA
Transcript >Ani_SJS100_1|g1765.t1
ATGGCCCAACCTGTCTCTTGTTGCTTGCCCAAGTTTGGCACGAGCACTCATGGGCCAAGGCGGCCTGCTTCGTTG
AGGATCAGGACGAGTCCTTCCCAGACTCTCCAGTTGCTAGCCGCTTGGGACCAATCCGAGTTAGATTCTTTACTC
AAGGCCACTTGGGCCTTGCTTCTTCATCGCTATACTGGCCTAGAGGACATTTGCTTTGGTTACCAACCGATTGGA
GTTGATGCCGGTCCCCGCGATACTGTTACTTCTTCCGATACCCATAATAATATTCCCTTAACTTTTAATCTGACC
ATTACCGAGGACGACTCTGTCCATGCCATTTTGCGCAACACAAAAAAGCAGAACGAAGCTGAAAAATGCGGAAGT
TCAAGCTCGAGTTGCCACAGTTATACCCTGTGCAATACCCTTCTAATGCTGCGCAACTGTCGCAGTGTTACGAAA
GATCCCAGAGCCCCTCTTGTGCAACCGGCCTTGGCAATTCCCTTGCCCGAAAAGTGCCGCGTCAGGCTGCACGTC
AAAGTCCTGCAGAAGGATGTCGGTATCTTCTTCGAATGGTGGAACAATGATATGTCCACTGAGCATATGAAGAGC
GTCGCCGACTACTTCGAGCAGATACTTTCACGCATACTCTCGGCAGAAGATACTGCCGCGAGGGACCTGAACCAT
TTCTCAGATCGAGATTGGTCCAGAGTCTGCAATTTCAACTCTACCATCCCCCAGGCACATGACCGCTGTATACAC
GAGGTCATTCATGAGCAAGTCCTGGCTCGCCCCGGAAGTGAAGCAGTTTGTGCGTGGGATGGAAGTTTGACCTAC
CAAGATCTGGATCTCCTGTCATCCCAAGTTGCTTATCACCTTCAAGCACACGGAGTCGGCCCTGAAAAATGTGTC
GCTCTGTGTTTCAACAAATCAAAATGGAATGTAGTGGCAATGCTGGGTGTTCTGAAAGCTGGCGGTGCTTTCGTC
CCCCTTGATCCAACACATCCAACCTCTCGTTTACAGTCGCTGGTGCACGCTGTGCAAGCCAAGGTCATGCTTTGC
TCCAGAGACCGAATAGGAGAATTGACTGGGGTAGCGGAGATGATAATACCACTGGACCAGGCTATCATAGACGAA
ATCTCCCTTCAAGCTGAAGAAATCTACTCATTGCCGGATGTACAAGGTCACAATGCAGCCTACGTGATATTCACT
TCTGGATCAACAGGAGAACCTAAGGGTACCATGCTAGAGCACAGAGCCTATGTATCCGGAGCCGCTGCCCATGCT
GGACCGCACCATATGTTTTCGACTTCACGCGTCTTGCAGTTTGCGGCACACACGTTTGATGCCAGTCTTGTCGAG
ATCTTGACTACCTTGTTGCAAGGCGGCTGTGTCTGCATTCCAAGTGAAGAAGAACGCTTGAGTGACATAGTCAAG
GTCATCAACGAGATGAACATAAACCATGCTATTTTGACCCCATCCTTTGTTGAGTTCATTGATTCCTCGCAAGTC
CCAGGTCTTGAGACCTTGATTCTTGCTGGAGAGGCGATGTCACAAGGCCAGCTGGAAACATGGTCGTCCGCCCTC
CACCTCATCAACGCCTATGGCCCCACAGAAAGCTCTGTTGCTGCCGTTGTTAACGCCAAAGTTACACCATCTTCT
GATTGTCGGGATATTGGACTCCCCGTGGGCAAGACAAGTGAAGCGTTCATCCATGATCCAGCCTGGATGAGAAGG
GACGGATTAAATGACTGTAACCGGAGAGTGTACAAGACGGGTGATCTGGTGAAGTTTCATGGACAGAGACTTGAG
TTGGGCGAGATAGAAAACCAGCTGGCTGCCGACCCAATTGTCAAACACTGTCTAGCTTTTCTTTCGAAGTCAGGG
TTCTCTGCAGGCAAATTGGTGGCGGTAATATCCTTATCTGTTCACTTCGAATCTCAACCGGAATCAAATGCAGCG
CCACTCAAGCTCCTTGATACATCGAAGAAGACCTCTATCGTTGCAGAAGTTCGCGAGAGATTATCAGCTAAACTA
CCAACCTACATGATACCCTCCGTTTGGCTGTGTGTGGAGGCATTGCCGTTGCTTCCGTCTGGGAAGCTGGACAGA
AAGGCGACCGCAAGATGGATTGGAGATATGGAGCGAGACCCGTATGCCCAAGCTATAAGCGCCAGGACTTTGTCT
GCGGATAAAGCCACACTTCCTTCGAGTGCCACGGAGGACAAACTCGCTGCGATCTGGAGCCGGGTTCTCAATATC
CCCCGAAGCCAACTTGCCCTTGACGAAGGCTTTTTGAGTCTAGGTGGAGACTCTATTGCCGCCATAACGTGCCTC
GGGTATTGCAAGAAGCAAGGAATGGGCTTGACGGTACAAGAGGTGCTTCATAGCAAGTCAATCAAGGAGCTGGCT
ACTCGGGTAAAACAGATCGATCAATTTGTTGTGTACGAAGAAAAGATCGATGAGCCCTTTGACCTTTCACCAATC
CAGAAGCTTCACTTCATGGTCCGAAACGAGGGCCAAGGCCACTTCAACCAAAGCATTCTTACACGCCTGAACCGG
CACATTGATGAGCATAGCATGCGACGTGCAATTGAGACCATTATCAATCGTCACTCTATGCTCCGCGCTCGCCTG
GTCGAATCAGACGTTGAGGGGATAATGCGGCAAAGAATAACTCAAGACGTAGCAGGGTCTTACCGTTGGCGTTCT
CACAACAACAGCAACCGAAGCGAGGTCGACCATGCTATCTCGAACAGCCAGTCATGCATCAATGCCTTCGTTGGC
CCCGTACTTGCAATAGATGTCTTCTATGGAAATGACCATTCCCGCCTGCTGTCACTCGTGGCTCATCATATGGTA
GTCGACATTGTTTCGTGGAGGATTATTTTGGAAGACTTGGAAGACCTACTGATGAACCCCGATCAACCGATATCA
CAGAACGGCTCCCTTCCGTTTCAGAACTGGTGCCAAATTCAAGCAGATCGTTGTCAAGAAGCGACAGCTGAACGA
ACCATGGATCTGCCTGAAGTTCCCGCACCCGATTTTGCCTACTGGGGACTAAAAAGCCACCAAACCACCTATGGC
GATGTGGATTGTGAAACGTTCGATCTTGACAGTGATATTACTCGCCACATACTGACTGGGTGCCACGAAAGTCTT
CAAACAGAGCCAATCGATCTTTTTCTAGCAGCTTTGCTACACTCCTTCGGCGAAACGTTCAAAGACCGATCATTG
CCAGTTATATACAATGAGGGACATGGGCGAGAAGTCTGGGACTCATCAATAGATATCTCTCGCACTATCGGCTGG
TTTACCACACTGTATCCCATTCTTCTATCGGAACTTCCTGCAAAAGATCCAACCGAAACGGTTGTACGTGTTAAG
GATTTGCGACGTTGTGTTCCGGACAATGGTCGACATGATTTCGCTCGTCGTATGTTGGTTCCACGCGAAGATGGG
ACTTGTCGGCACTATAGCCCCATGGAGATGTCTTTCAACTATGTGGGCCAGCACCGTGACCTACAGAGAAAGGAT
GGGCTCTTCCAACTCATGGATCAGATGGCTGGAGAAACAGGCCGCGGAGGTGCAGCGGCTGATTTTGGTGAAGAA
ACTCCTCGCTTTGCACTGTTCGAGATATCTGCGATGGTTGTGCAGGGTCAACTTCGCTTTATCTTCTCCTTCAAT
AGGAATATGCAGCATCAGAATGGTATCCGTAACTGGGTACACTGCTGCAAAACATTACTGGCATCCCTGGGCGAA
CGCTTACAGGCTCTCCCACCGAAACCAACGCTAAGCAGTTTCCCCATGTTAACATTGACATATACCGAACTCGAT
GCGTTGGTGTCGAAAAAATTACCGGATGCCGGTATTCATAGTCTTGATGATGTTGAGGACATCTATCCTTGCTCC
AGAATGCAGCAGGGCATTCTACTCAGTCGCTCTCGCGATAGCTCACTTTATGCTGTACATGACACATTCGAAATA
TCCGGGCCAGGAAGCACACCCGACATCAACCGATTGATACTTGCCTGGCAGAAAGTCGTTGCTCACCATGCAATG
CTACGGACTATATTTCTGGAGGGGTTGAGCAGCCACGACCTACATTGTCAAGTGGTGCTCAAATCGTTCGATTCC
CGCCCAACTTACGTCGTATGTGCGAATGAAAGCGAAGTGCTACCTACATTTGACAAACAGCAACCGATGAGCTAC
GATAATAATATACCTCCTCATCGGCTTACAATCTGCCAAACGGCTTCTGGGAAGCTGTTTTGTCGACTGGAGCTG
AACCATGTCGCCATGGATGGCGCATCAATCTCCATCATCCTTCGGGATCTGCAATTAGCGTACCAAGGAAAGCTC
GAAGAACCAAAGCCGAAGTTCAAAGAGTATATACGCTACCTTCGTGAGGTTCCCCAAGTCGCAAGTCTTGACTAT
TGGCGCAATTATTTGTTGGATGTCCAACCTTGTCATTTCCCCGTGCTCAATGACGGCAAAGGCTCTGTAAGGCAG
CTTCGGACCAAGAGATTGGGCGGTGTGCCATTCAAAGAGCTACGAACCATCTGCGATATGAATGGTCTGACCCTT
CCGACTGCCTTTAGTGCTGCATGGGGATTAACGGTTCGCTCCTTTTGTGGATCAGATGACATCTCCTTCACCTAT
CTTGCATCACTAAGAGATGTCCCAGTAGAGGGCGTTGAATATGTTGTTGGACCTGTCATCAATACCCTGACCTGT
CGTATGCTGTTTGCTAAAGGGACGTCACTGAAGGAGATCCTCGCAAAAGTTCAACAGGATAACCTGGACAATTTG
CCGCACAGGCATATCTCACTCACGGAGATCCAGCAAGCTTTGGGACTAACAGCCTCATTGGCTAATAGTGGTATT
TCTTACCGGAAGCTTCCCAATCAGAATGCTTTGTCAAGCGAGGAGATACAGTTCTCTGAAGTGGGGACAATTCAC
GACCCGGCAGAGTCGCCCGTTTTTGTCAATGTTGAAGCTACAGAAGACGACGCACGTATCGACCTTAACTACTGG
ACAGACCACCTGTCGGACGGGCAAGCAGAGAATGTCGCGAGCACATTCCTTAAATCGGTTGAAAATATTGTGCAC
CACTTTGAGGATGACGCCCATTCAATTGACAACTTTAGCGACGCGAACAGACAAAGCCTAATGCTTTGGAATAGC
GAAGTCCCAAAGTCCATCGACAAATGCATGCATGAGATAGTTGATGAGTGTGCGAAATCCCACCCTCACACCATG
GCAATTTCTGCTTGGGATGGAAACCTCACTTATGCTAAGCTCAATGAATTGTCATCGCTACTTGCAACGTACTTG
ACAACACTAGGGGTGGGCCCCGGAACAATCGTGCCCCTTGATCTCGCTAGATCCTCCTGGCAAGTTGTAGCCATC
TTGGCAGTCATGAAGACAGGTGGTGTATGTGTTCCGGTGAACCCAGCCCGACTGCCACAACATTTCGAGACTTGG
CTCGTCGACAATGAGATCCAGGTTGCCCTAGCATCACCGACTCAAATGCAACTACTCGAAGGGGCCGTTCCATAT
GTAATTTCCGTGGAGAGCTCTCTGTTTGAATACCTTTCAGACAGTGATGCAGTTTCAAGCTCACCAATTCAGCCA
TGCAGCGATGCATATATCGTGTTCGGCGCTGAGAGTCCCAAGTGCATCTTGATTGACCATCGTGCAATAACAACC
CGGGCAAGCGCGTTCGCTTCAGGTCTTGGACTAAATGCACGAACAAAGATGCTCCAATACGCTCCATATACTTCT
GACATGTTCCTTCAAGAAGTCTTCGGCACGTTCCTGTGCGGTGGGTCTATCTGCATTCCGTCAGATGAAGACCTG
GCAGACCTGTCAAAAACCATCAAGACAATGCAGGCGAACTGTGTCAGTATCACACCCTCAACGGCGATGACTCTA
AGATCCGCAGAGGATCTGGGGATAGAGGTCCTTGCTTTATGGGGTGAACACCCGACCAAGCAACTTCTTACCGCC
TTGCCTGGAGGAATCCAAGTGCATGCATTCTATGGAACGCCAGAATGCTCATCTTCTTGCATTCGATCCTCTCAG
CTTGACGGATCATGCGAATCGTCAATTATTGGGTCAAGTCTTGGATGTAAATCTTGGCTTGTAGATCCCTCCGAT
CACGATATTTTGGTTCCGATCGGCTGCGTTGGCGAACTGATGATAGAAGGCCCAAGTCTTTCTCATGGTTACTAT
CAAGATGCGGAACTCACGCAACAATATTTCGTCGAAAATCCCTTGTGGAGACTGGCTTACGAATCCCAGCCATCA
TCAGACAAAGACAAGAACACGGACGCCCAGAAGCTGTCCTATCGATTGTTCAAGACTGGAGATCTTGCTCGCTAC
AACTCCGATGGCACACTCGTTTACGTTGGTAAGAAAAATAGAGGGTTGCATTGGCAGCGACAGACAGCGGCCATT
TACGTCGAAGAGCAAATCGCATCTCTCTCATCCTTCAATGCCCAGTATGTCGTTGAGGAGATCAGCAAGAGCAAT
GTCGATTCTCCCCGATCGTCTCTGGCCATCTTTTTCTCTGATGAGGCCGTCGACTCCAAGGGACACCACCAGCCT
ATTGCACAATTGTCACCTGAGCTGCACGACACAATGATCAGGCTGTATAAAAAGCTGTCGAGCTCCTTGCCAGCG
AATTCTGTCCCGAGACTGTATTTTCCGACGTCTAGCATACCACTGAACTCGTTCGGTAAGCTGGACCGCCAGCTG
CTGAGAAATGCGGCTCAAAATCTGCCAGAAGAATTGCTGTCTAGATTCGACATCAAAAGCTTTGACAGCTTCTGG
AAAGGGCAGCTGGCCACATTGGCGCTTTCGCCAGTGTTCCCGTCACCCCGTGGCTCTTCGTCTCAGCGGAGCACA
CCGGTCACCAAGCAAGCAACAAAAAACATGCAGATGGTCTGGTGTGATACACTCAGATCAATGACCGAAGGTACA
CGATGTGCTATCCTTTCTGCATGGGCTCTTACTATTCGCGGCTACATCAGCTCCCGTGATATTGTTTTTGGGGAG
TTGCTGTCAGAAGTTGAATTGGCCTCCACTGAGCGTCAGGACAATTATACGCAAGCTGCAACTATCGTTCCCCGA
CGCTTCCAACTCAACGATGATTGGACCATTACTGAGTTACTGAGCAGGGTAAAGTATCAACTGGAGTCAGCTAAG
CCCTACCAATGGGCTGGAATAAGTCAAATTCAGAAATTGAACGCTGATACGGCGCGCGCCTGTGATTTCATGAAC
TTGATCTCTATAACGGACAATCGTGGCCTTGAACCAAGACTAGTACCCATGAAACAGCATGACAGCAATCTTTCC
GGTTATCCTTTGATGGTTGATTGTATCCTTGGAGATGCTACGCTCGAACTCTTGATTAGTTACAATGACAGCACT
TTAACAGGCACCCAGATCGAGCGACTGGCTGCCCAATTCTTCGCTTGTGTTGGACTTCTTAACTCCAAGGCTAGC
ATGAACAAGACAATCGGTGTCTTGTCCAGAGACAACATGGACTTTTGCTCCTTCCGCCATGATGTTGCCTACTGG
AAAAACTATTTGGAGGATGTTGAAGCTTGTCTTTTCCCGGCACTACGTGCAAGTGCGGAGGAAAATACTCATGCT
GAGACCCAGATAATACTCCAGAACACCAAGCATCTACATGATCTCAGTGAACGTGAACGTCTCAGCAAAAGCTCG
CTTCTTCAGCTTGTTTGGGGCTTGGTTCTGCGATGCTACACAGGCCTACAAGATGTGTGCTTCGGATATCACATT
CCAGATGCAAGCGACAGATCTGCCAAGCCTGGAGTTGCGAATAAGCCAGATATTTCAGGTACATTCCCGTGCAGA
ATGCTCTTGAATGGTGAATCTAGGGTTGCGGAAATTTTGAGAGAGCGACTGCAAGGACTGAATCAAATGCAGCAG
CATCGGTTGCCGTGGGATGAAGTCCAGCAAGAGCTTGGGTGTAGCGACATTTTCAATACCGTTTTCACTTGTTCA
GAACAATCAAGTGACGCAGTAAATGTGGCTGGTCTCGCTGATCTTGATCCGAGCAAATACCTGATTACCGTCAAC
GCCACTCTAGCAGAATCATCAGGAGTCATTAGGTTCGGCTATCAAAGGAGGCACTTCTCAGAAACCGACATGGAA
GGCGTCCTTGATTGTTTTAATAATATTCTGGGACAGTTACTCCAATTCCCTCTTCCGGATCTTTTGGTAGGCGAG
GTTGACTTTGTGAGTGAGCTTTCCTGCCAGAAGATATCTGAGTGGAACTCGGCGCTGCCAGACCGTCCAGTGCTA
TGCGCGCATGAGCTCATCCAACAGCAAGCTTTGGATCGTGCTTCGGCTCCTGCAATTTGTTCTTGGGATGGCAAC
TTCACATATGCACAACTTGACCGATTGTCGACTCTCCTAGCAAACCAGCTGGTGGGCTTAGGGGTCAAGCCCGAC
ATCTTCGTTGCATTGTGTTTTGAAAAGTCCGCATGGGCGGTTGTTGCACAGGTTGCTGTTTTGAAAGCTGGAGGA
GCCTTCGCTTCATTAGATCCAGCTCACCCAGAAAGCCGCCTACAAGGCATGATCGATGATCTTGGCGCTCAGGTT
ATTCTTTGTTCTGAGACACACTACGAGAGAGCCTCCAGCATCTGTCGTCGCGCAATGATCGTAAGCAATAGCGCA
CTTGAACAACTTCACCACTCACCCTTTGCTGCTCCGACCCAAGAGGTAACCGCTGATAACGCAGCCTACGCCATA
TTCACATCGGGAACCACAGGGAAACCCAAGGTGACAGTACTTGAGCATGTTGGACTTACCCTAGCCTGCACAGAG
CTCTCCAGGGCCTTCTTCATAAGTTCAGAAACACGCGCTCTGCAGTTCTCAAGCTATACATTCGACGTCAGCATA
TTGGAAACTATAATAGTCCTTGCTGCTGGTGGCTGCATTTGTATCCCTAGCGAAGATGAGCGCATGAACAATCTT
TCTGGAGCCATCAGAAAGATGAACGTCAACTTCATGAGCTGTACTCCATCTATCGTTAATACCATGGACCCCAAT
GCTGTTCCTTCATTGCGAACAATAACTCTCGGAGGAGAAAAAATGACTGCAAGCCATTTCGAGCGATGGGCTGAC
AGGTGTGTTATTAACGCGTACGGTCCGTCAGAGGCTACTGTCGCCTTTACGTCAAGCACGAAATACGACCATGCA
GGAGTACGCCTTACTGATGACTATGGTTCTATTGGCACTGCTATTTGTGGCAGGACATGGATTGTTGATCCCCAA
AATCACAATCGACTTGTGCCCATCGGCGCACCCGGAGAGCTCGTTCTTGAGAGTTGCACTGTTGCTCGTGGGTAT
CTCAATAATGACGAGAAAACCAAGGCTGTTTTCATCCGGGACCCGGAGTGGACTCAGCGTGAAGGGCTACAGCAT
GTGTTGAGGCGCAAAGAACGGATGTATCGCACGGGAGATTTAGTGCGCTACAACTCCGACGGCTCGATTGCTTTC
ATTTCGCGAATTGATACACAAGTGAAATTGAACGGTGTGCGCATCGAATTGGAAGAAGTTGAGCAACAATGCAAC
AACTATCTTTCGACAGATACTCAGGTTGCCGTTGAGGTTGTTACTCCAGAGGCCAAAACTATATCAAAATGCTTG
GCTGTCTTCTTCACCATTGACGAGCATCAAATGAAAGATATGGCGAATGGTGAATTCATTTTGCCCATGTCAGAG
TCTGTAGTTCACATGGTCAAGAAGCTACACGGTTCCCTAAGCGCTTCATTACCGCTAGCTATGGTGCCCAAGCTT
TACTTCCCCATGCGGCGCCTGCCGTTTGGAAGCACTGGCAAAACTGATCGCAAAGCACTTCGAGCAATGGTCGAT
ACATTTACCAAGGAACGCTTGAGACCATATGTTATCTTCAATGTTGGCGCAGAAGAACGCTCCGATGTGGGAACG
GAAGGGACAGATAGCGTTCTCAAGACGCTATGGGAGGAAGTCCTTAACCTTGCGCCAGGTTCTATCAGTGCCGAA
GACAACTTCTTCGGCATGGGTGGCGACTCGTTTTCTGCTATGAAATTAGTCGTAGCCGCGGCATCCCAGAATATT
TCACTTGCAGTGGCCGACATATACCGAACTCCTATTTTCAAAGACATGGCAAAGAGATGTGGAGCGGGTGAGGTT
AAGACTGGTGTACCAACAGTGGACCCTTTCAGCATGCTGCCTGAATCTCTTCCACGCGATGATATTCTGGAGGAA
GTCTCTGACCAATGTGGTGTGCCTATGGATCGAATTGCGGACATCTACCCGTGTAGTCCGGTGCAAGAGGGTTTG
CTCACACTTTCTATCAAGCAACCCGGAGCCTATGTCGCTCGACCTGTGTTCCAACTCGCAGAGGGAGCTGACCTT
GACAAGTTTAAAGCTGCTTGGCAAAAGGTGGTTAATGAAATGGATATTCTTCGGACTCGGGTAGTACACACCGAG
TCCGCCAACTTTGTCCAGGCAGTGCTCACTGATGTCCCTATCCTCTGGGAAACGGCAACGGAATTGGACGATTTA
GCAAACGACACTATTGACCTAGCCAAGAATAACGGGGGCTTGCTAACTGGATACGCCATTGTCGAGTCCGGACAC
TCGCGCTCCTTCGTTTGGACCATACACCACGCTCTCTATGATGGATGGAGTGTGTCCCAGATCCTTCAAAGAGTT
GAGGAGATATACTCGGGTGCTTCAAAACTTAGCTCGACGCTTCCTTATAAGCTCTTTATCAATCACCTGGTCCAG
CAAGAGGCTCATTCCTCGGACGAATTCTGGAAGACGCACCTCGCGGCCCTGTCTTCATGTCCTTTCCCCCAGAAC
AAGCCGTCACCTGATACCATTCGCGTCGGCAATCGGCATTACAGCTCGCTTGAGATTTCTCGTGCATCAAGTGGG
CCTAAGTTAACCGTTCCTGAAATGATACGAGCTGCATGGGCACTAATTGTATCCGTCCACACCGGTTCCGGAGAT
GTCTGCTTCGCTGAAACCCTAATGGGTAGAAATATTGATATGCCTGGGGCTATGGAAGTTGCAGGACCTCTTTTG
ACCACGGTTCCTATACGGATGGCTGTCAACAACGAGCTCTCGATTATCCAGTACCTCGATAATGTGCGCCAGCTG
ACCACAATGATGCTCCCGCATCAACATTCTGGGCTCCAGAGGATCCGCAAGCTAAGCAGCGACACTGCCCTTGCT
TGCGAATCCCAAAATCTACTGGTTATTCAATCAGAACAGGCCCATTCGAACACAAGTATCTGGGAGCAAAAGGAT
AACCTGACTGAAGGCGAATTTTTCACCCACCCAATTGTTGTCGAATGCAAGGTTGGCGAATCGCAGGTGGCCGTA
ACCCTTCATCACGATGAGCTTGTTTTCGACAGTTGGCAGGCTAAGATGCTCATTGAACAGTTTACCTTCGTTTTG
AGTCAACTGTTATCAATCTCCAATGAAGAATCCAGAAAGATCGGAGAGCTAGAGGTTTCCAGTTCTCGGGATAAG
GAAGAAATTGCTCTCTGGAATGAGAGAAACCTGACTTGCATAGACAGATGTGTTCATCATATCATTGAGGAGAAA
GCATCCCTCCGACCTCAAGCTCAAGCCGTCTGCTCCTGGGATGGACAACTAACTTACCAGGAGCTTTACCAGCTT
GCTTCTTCGTTTGCAGCTTACCTGAAAACTCGTGGCGTAGGTCCGGAGACTTTGGTTCCGATCTGTATGGACAAG
TCTTTGTGGGCCATTGTCACAATACTGGGTGTCCTCATTGCGGGTGGAGGATATGTCCCCCTTGACCCTGCTCAC
CCAACGTCAAGACACAAGGAAATTCTGACTGAGGTCGAAGCCCGTGTCGTTCTCTGTTCTCCCAAGTATCAAAGT
CGGTACACTGGCTCTGTGAAAGCAATCATCCCTGTCAGCAAAGAGACGATCAAGGCGTATTGTGCTCTTAGAACG
GCAACTGCTAAGACTACTAACAACGCTACACCCGAAAACGTTGCATTCGCTATCTTTACCTCTGGCAGCACTGGT
CGTGCTAAGGGTATTATCATCAACCACAAGGCACTTGCCAGCAGCGGCATGGCATTCGGGCCCATGGTGCACCTT
GACGAGAATTCTCGAGCTTTCCAATTTGCCTCTCTTACTTTCGATGCTGCTGTCATGGAAACACTCGTCACCTTG
ATGCACGGCGGTTGCGTGTGCATTCCAAGCGAAGATGAACGCTTGAATGATGTTGCTGGCGCTATTCGTCGGATG
AATGTCTCTTGGTCATTCCTGACTCCATCCATAGCCAGTATCATTGAACCGTCATCCGTTCCATCTCTGAGGGAC
CTTGTGTGTGGTGGAGAGAAGATGTCTCGCGAAGTCATCACCAAATGGGCACATCGGGTAAACCTGATGAATGGA
TATGGTCCAACTGAAACTACTATCTTCGCGGTTATCAACACAGATGTTGCTGCCAACCCGGATCCCGCCTGCATC
GGCCATGGCATTCCTTGCACCCTAACCTGGGTTGTCGATCCTGATGACCACAACAAACTAACTCCTCTAGGGGCT
GTTGGTGAGCTGGCACTGGAAGGCCCCGCACTTGCTAGGGAATACCTCAAGAACCCTAAGAAGACAGCAGAGGCT
TTTGTGGATGAGCCGGAGTGGATTAAGGCCTTCCCTAGTGTCCTACCTTCGCCCAGAAGAATATACAAGACTGGA
GATCTTGTCAGATACAACTCTGACGGTTCCATTCAATACATCAGCCGCAAGGACCATCAAGTCAAGCTTCACGGG
CAGCGCATGGAGCTTGGAGAGATTGAGCACAGACTATATGAGGACCCGCGAGTCCGCCACGCTGTGGTCTTACTG
CCAACGGCAGGTCCCCTCAAACAGAGGTTGGTCACTGTTCTTTCACTGAATTCTGTAACTGCGGAGAAAAGCATC
ATATCAGACAATGCATGTGAACTTGTCGATCGGGGTGGATCTGCACGGGCAGCATACCAGGAGCTCGTTGCTATC
CAGAAGAGCTTAGAGACACAGCTACCAATCTATATGGTTCCACAGGCTTGGGCTCTGATCAAGCAGCTCCCAATG
CTCGTGTCTGGCAAGCTAGACAGGAAGCGAATCACAGCTTGGCTGGAGAACGTTGATGATGCTGCTTATGATCGC
ATAATGGAGGATTACGACAACATAAAACGTGGGGATGTCGAGCAAGACGAGGAGAAAGAGGATGACCGAGAGACT
TCTGTCAAGCTTCTTCAGGAAGTCTTTTCCCAGGTTCTCAACTTACCATCTCACAAGGTGGGCTTGGACAAGTCA
TTTGTGAGCCTAGGTGGTGATAGTATCACTGGAATGGCTGTCATTTCTCGAGCGCGTAAACATGGACTCACGCTG
ACCCTCCACAATGTGCTTCAGTCGAAGTCGATAAAGGAGCTTTCTCTAGCTGCTCAGACAAGCGTCAAGACAGTG
AAAAGAGAGGAGAAGCCTCATGAATACTTCGAACTGTCTCCGATCCAGGGATTGTTCGTTCAAACAACAACAAAT
TTTCGGGATTCTTCTCGCTTTAACCAAAGCATGACAGTTCGCGTTACTCGAAGGGTCGAGCCAACTAGAATGCAA
AGCGCCATTAAGGCTGTTGTTGAACAGCACTCCATGTTCCGAGCACGGTTCTTCAAGTCTCGCGACGGAAAGTGG
AAGCAGAAGATCAGTGATGATGTTGATGCCTCATACCGCTTCCGTCATCATATGGTGGAAAATAAAGATGCAATT
CTCCCCAAGATCGCCGAGTGTCAACGGTCTGTAGATGCTCAACATGGACCCATCGTTGCTGCAGACATGGTCCAA
GTACGCAACGGCATCACAATACTTTTCCTAGTGGCCAGTCATCTATGTGTTGACATGGTATCCTGGCGTATTGTC
CTCCAGGACATCCAAGATTTCCTCGATGCTGGATCATTGTGCCCAGAGAAGCCCCTGTCATTCCAAGCTTGGTGC
AACCTTCAGCTTGAACAGAGCAAGAAACCAAATGGCAGAGTCCAGCTGCCTTTTTCTATTCAGCCTCCTGACCTG
AAATACTGGGGCATGGAGCAGTCCCAGAATCTCTATGGGGATGTCAAGATGGAAGGGTTCACGCTTGATGCCGCA
GTCACGACACAAATCCTCGCAGCCTGCAATAAGGTTCTACGCACCGAGGCTATTGAAGTCATACTCTCCGCTGTT
ATTCACTCTTTCCGTCGCACGTTTACTGATAGAGAAATGCCGACTATTTACAACGAGGGCCACGGTCGCGAGGCG
TGGGACAGCTCTATCGATCTCTCAAGAACGGTGGGCTGGTTCACGACTATGTGTCCACTGCATGTTGGTGAAGGG
TCGGATCTACTTGACACTTTGAAGCGTGTCAAAGACACAAGGCGTCACCTCAGCAGTAAGAGCCGGTCATACTTT
GCGGAAAGCCTGCTTCAGCCGGAAGGTAAAGAGGGCGATGCTTTCCCTGTCCCGCTCGAGATTCTGTTCAACTAC
CTTGGCCAGCTGCAACAGCTAGAGCGCGATGATTCGCTTTTCCAACATTATGGTGAAGCCTTCAACGCGGAGACC
TTCGAGATGACAGGGGACATGGGCTCAAAGACACCTCGGTTTGCTCTCTTCGAGATCTCGGCGCTTATTATCAAG
AACAAGCTTCAGGTATCGTTCACTTACAATAAGCACATGCAGAAAGAACAGCGGATCAAGGGCTGGATATCTGAG
TGTAAACGAGTGCTGGAGCATATGTCTCGTTTCGAGAGCTTCACGTCTGAGCCGACACTCAGCGATTGTCCCTTG
CTCCCCATCACTTACGAAGGCCTGAACAACATGGTCAAGAGAGCATTCCCCAAGATCGGAATTGATAGCTGGGAT
CAGGTTGAGGAGGTTTATCCCTGCTCCCCAGTACAAGAAGGTATCCTTCTTAGTCAGCTTCGAGACCCGGAGGAA
TACCTGTTCCATGTCATCTTCGAAGTGCACCCATCCAAGGGTAGCAAGGTGGATACAAGCAAGCTTCGAAAGGCA
TGGTCCATGGTTGTCAGCAGGCACCCTATCTTACGGTCTGTCTTCATTGACAGCAACTACAAAGGCGGATCTTTC
GACCAGGTAGTGGTCAAGTCACTCGACGATGAGGTCATTGAGTTCCAGTGCCCTGAGTCGGATGCATTGGGTACA
CTTGGGGAAATAAAGCTGCGCGATATCAATGCTGAGAGATCGATGAAGCTCGCCCACCAGATGACCCTCTGCAAA
ACAACTTCTGGGCGAGTCCTGTTCAAGATTGAGATGAACCATGCCATTATCGATGGCGGGTCGGTTGACCTGCTT
CTTCGGGATCTCGCCCTCGCATACAGTGATCAGCTTTCTGCCGGAACCGGTCCACGCTTTAGTGATTATGTCAAG
TATATCAGGGAACAATCCCAGGGAGAAGCTGTGGCACACTGGGTGAAGTATCTCTCTGGCGTACGACCTTGTCAC
CTCCTGGTATCTTCCAAAAAGAGCGGTAGCCACCAGCTCGGCGAGCGCATGATATCTTTCAAGCGCTTTTCTGAG
TTGCAAAGATTCTGCGAGGAAAATTCCGTCACACTCGCCAACTTGACCCTCTGTGCCTGGGCAATTGTACTCCGG
AATTGTACAGGATCTGATGATGTCTGCTTCGGATATCCGTCTGCTGGTCGTGACTCCCCTGTTCCTGGGATCCAA
GATGCGGTCGGTATCTTCATCAACATGTTGTGCTGTAGAGTCAAGTTCTCTCCCGGACAAACACTTCTTGAGATT
GCCAAGAAGGTACAGGATGACTTTGTCAGGAATGTGCCGCATCAGCACTGCTCTCTGGCTCAGATCCAGCATGAG
CTTGGAATGCATGGAGAGACGCTCTTCAACTCAACTCTTTCCATTCAGAGTCGCTCTGCCAACAAAGGCACTGGA
AATTTGCCGCTCGACTTCGACGCCCAAAAGGCCCATGACCCAACTGAGTATCCTGTTACTGTAAATGTGGAGACT
ACCAAGGGCAAGGAGGGAGTTTTGCTGAGGTACTGGAGCAACGCAGTGACCGAAGCACAAGCAAAGGAGCTAGCG
GAAGCTGTTACCAAGGTCTTCACATGCTTCATCGAGGAGCCATCCAAGCCGGTATCGAGCTTGAACCTCCTTAAC
AAGCTACCGCGGAACCGTTCGCAGCACACCCACAGAGAGCCCCTCATTTTGGACCAATTGATTGACAGTCAGGTC
CTACAGAAGCTAATTGACGATCGCGTGAATGAGATAATCAGCCAGATGCTGAAGGAAGGCAAGCTCGCCATACCC
CTTCCTGATCAGAAGACTAGATACTCGAACAGCTCTGTTCAACTCAAGATGGTCGAGGCTTCGCTCCAGAAGGAT
CCCATAATAGACGAAAAGGATCTTGCAAACTCAACACCATCCCTAACAGATGATGGCAGAAGCTCAAGTGACAAT
GATAGGCGCCTTTGGGACCTGTGGAAGTCGACATTAGGGCTATCTTCAGACACTATCCAATACCGGAGTAGCTTT
TTCAAGCTAGGCGGTGATAGTATTACAGCAATGAAGATGGTCAGCGCTGCACGAGAAGAGGGCTTGCAAATGACA
GTGGCGGATGTGTTCAACAACCCGATCTTCGAGGACATGCTGGCTACGATTACTCCGAGCAGCAGCCCGACCTCA
AACGCCGATACCCAGTGCGCAAACAACATTGAAAAACTCCTGGAGGTTGATGATGCTCTCCCAGATGCTACCCCA
CCGCAGGATATCTCGGTGCTTAGGCCAATGCAGCTCGATGCCATGTCTCTGCTTGATGTCATCTGCCCTAAGATA
GGGGTGTTCAAAGGAGGAATTGCTGATGTTCTCCCTGTTACGGACTTCCAATCCATGTCGATCGCTGCCACGCTC
TTCGGATCGAGGTGGATGCTGAACTATTTCTTCCTCGATGGAAGTGGTCCTCTAGACCTTCGACGACTGAGGGAA
AGCTTCTTGAGGGTGGTCGATGCTTTCGATATCCTTCGGACTGTTTTTGTCTGCCACCACGGGCAGTTCTTCCAG
GTGGTGCTGAGAAAAGTCCGACCGGATATTTTTGTGCATGAGACGGAGCAGAGTCTAGATGAGTACACCAACGGC
TTACAAAAACGGGACCGTGAACAAGATCCACGCCAAGGTGAGCAGTATGTGCAGTTCTACGTTGTCAAGAAAAAG
AATAGCGACCAGCATCGCATCTTGATCAGGATGTCGCATGCCCAATTCGACGGCGTTTGTCTGCCAAAAATTATG
AACGCAATCAAGCTGGGATACGAGGGCAGCACCCTACCTCCAGTCTTCTCCTTTTCGAACTATATGCGGATGCTT
CCTGGAAACATCACCCCGGCACACTACCACCACTGGTCAACAATACTCAAGGGCTCTAAGATGACCGATATCATT
CGGCGCACGCAGCCTAATACCTTCATGCATATTGGTGCTTTCGCTGAGCAGAAGAAGACGATAATGATACCCTCA
ACCGCCATAGGAAATGTCACCCTCGCGACCGTTATGCAGTCCGCATGGGCGGTGACTTTGGCAAAACTGACTGCC
CAGTCGGACGTGGTCTTCGGGCTTACAGTCAACGGCCGTAACGCCAGTGTTCCTGGTATTGAGACCACTGTTGGG
CCCTGTCTTAACATTCTTCCCATTAGGGTTAAATTCAGGGAGCATTGGACTGGCCTTGACCTCTTCCGTTATCTC
CAAGATCAACAGATCGCCAACATGCCCTATGAGTCGCTAGGATTCAGGGAGATTATCCGGAACTGCACCGATTGG
CCCGACTCCACATACTTCACCACCTCCGTGTTTCATCAGAATGTCGAGTATGAGGGACAGATGCATCTAGACGGC
AATTCGTACCGGATGGGAGGCGTTGGTGTTTTGGACAACTTCACTGATCTCACGCTGGCCTCCAAGTCCTGTGGT
CAAGAGAAGCTCGATGTCTCAATCGGGTACTCGCTCAAGGGCCCCATTCCAGCAACCTTCATCGCTAAAGCCCTT
AACATGGTTTGCGAGACTGTGCAGAGCCTGATTGCCAACCCCAGCGTCCCACTTGCGTCCCCTGCCACTATCCGC
TCCCTGCCTAGCCAGATCATTCGTGAAACACCCAGAGCATCTGATACACCCTTCCTCTCGTCAAATCTAAACAGC
CAGAAGATGTCGGAGATTGTAATTCACTCAGATATCCTTACCCGGTCCTGGCAGCAGGTGCTACCCCGTCAGACT
GACAACCCACAATACCAACTCGATGCATCTTTCTTCGACCTGGGCGGAGACATCATGAATGTTGCCCAACTGGTC
TGGATTCTGGGAGAAGAAGGCTTCAGTGTCCGTTTGGAAGACCTTCTCGAGCACCATACGTTCCTGGGAATGATG
GCCGTGATGGCGATGCACCACAAGCCGGAACTGAATGCCAGAATGGCAGCGACCATGGCTGAAGAACCAGCCAAG
GAAATGAGAATGACTATGACAAAGAGCAACAGCTGGAGCTCGCTGGGCAAAGCGATGACGCTTGCTAAGAGATTT
ACTAGATGGGGGGCTGTAGCAGCCAAAAAGTGA
Gene >Ani_SJS100_1|g1765.t1
ATGGCCCAACCTGTCTCTTGTTGCTTGCCCAAGTTTGGCACGAGCACTCATGGGCCAAGGCGGCCTGCTTCGTTG
AGGATCAGGACGAGTCCTTCCCAGACTCTCCAGTTGCTAGCCGCTTGGGACCAATCCGAGTTAGATTCTTTACTC
AAGGCCACTTGGGCCTTGCTTCTTCATCGCTATACTGGCCTAGAGGACATTTGCTTTGGTTACCAACCGATTGGA
GTTGATGCCGGTCCCCGCGATACTGTTACTTCTTCCGATACCCATAATAATATTCCCTTAACTTTTAATCTGACC
ATTACCGAGGACGACTCTGTCCATGCCATTTTGCGCAACACAAAAAAGCAGAACGAAGCTGAAAAATGCGGAAGT
TCAAGCTCGAGTTGCCACAGTTATACCCTGTGCAATACCCTTCTAATGCTGCGCAACTGTCGCAGTGTTACGAAA
GATCCCAGAGCCCCTCTTGTGCAACCGGCCTTGGCAATTCCCTTGCCCGAAAAGGTGGGTGACTTTCCTCGTTCT
TTGGCGTCCTCTCACTTTCTCTTCGCTCCATCTCCCCTTCCCCCCTCCCACCTTCGATCGTGTGCGCTTCTATCA
GCCCACCGCTGCAGGTGGCCTTGGCCTTTTAACCCGGACTGGCTGACCTCTCTGTAGTGCCGCGTCAGGCTGCAC
GTCAAAGTCCTGCAGAAGGATGTCGGTATCTTCTTCGAATGGTGGAACAATGATATGTCCACTGAGCATATGAAG
AGCGTCGCCGACTACTTCGAGCAGATACTTTCACGCATACTCTCGGCAGAAGATACTGCCGCGAGGGACCTGAAC
CATTTCTCAGATCGAGATTGGTCCAGAGTCTGCAATTTCAACTCTACCATCCCCCAGGCACATGACCGCTGTATA
CACGAGGTCATTCATGAGCAAGTCCTGGCTCGCCCCGGAAGTGAAGCAGTTTGTGCGTGGGATGGAAGTTTGACC
TACCAAGATCTGGATCTCCTGTCATCCCAAGTTGCTTATCACCTTCAAGCACACGGAGTCGGCCCTGAAAAATGT
GTCGCTCTGTGTTTCAACAAATCAGTAAGTTTAACATCAAAGATCGATATGTCCTTTGGGGCAGGTTGTGTCATC
AAGTGACTCTCGGCATTTTCGCTATTCGGGACTGACTGATTCTCATAGAAATGGAATGTAGTGGCAATGCTGGGT
GTTCTGAAAGCTGGCGGTGCTTTCGTCCCCCTTGATCCAACACATCCAACCTCTCGTTTACAGTCGCTGGTGCAC
GCTGTGCAAGCCAAGGTCATGCTTTGCTCCAGAGACCGAATAGGAGAATTGACTGGGGTAGCGGAGATGATAATA
CCACTGGACCAGGCTATCATAGACGAAATCTCCCTTCAAGCTGAAGAAATCTACTCATTGCCGGATGTACAAGGT
CACAATGCAGCCTACGTGATATTCACTTCTGGATCAACAGGAGAACCTAAGGTGCGCTATTCCTCGAAGCTTCCC
CCAGATCCACATTAACAGCCCGCGTTTAGGGTACCATGCTAGAGCACAGAGCCTATGTATCCGGAGCCGCTGCCC
ATGCTGGACCGCACCATATGTTTTCGACTTCACGCGTCTTGCAGTTTGCGGCACACACGTTTGATGCCAGTCTTG
TCGAGATCTTGACTACCTTGTTGCAAGGCGGCTGTGTCTGCATTCCAAGTGAAGAAGAACGCTTGAGTGACATAG
TCAAGGTCATCAACGAGATGAACATAAACCATGCTATTTTGACCCCATCCTTTGTTGAGTTCATTGATTCCTCGC
AAGTCCCAGGTCTTGAGACCTTGATTCTTGCTGGAGAGGCGATGTCACAAGGCCAGCTGGAAACATGGTCGTCCG
CCCTCCACCTCATCAACGCCTATGGCCCCACAGAAAGCTCTGTTGCTGCCGTTGTTAACGCCAAAGTTACACCAT
CTTCTGATTGTCGGGATATTGGACTCCCCGTGGGCGTACGTTGCTGGGTTGTAGACCCGAGCAATCATGACCAAT
TAGTACCCGTGGGTTGTCCGGGTGAATTACTGCTTGAGGGACCGACGCTCGCTCGATGCTATCTCAACAATCCTC
AGAAGACAAGTGAAGCGTTCATCCATGATCCAGCCTGGATGAGAAGGGACGGATTAAATGACTGTAACCGGAGAG
TGTACAAGACGGGTGATCTGGTAAGATACAACTCCGACTGTGGCTCACTGACGTATATAGGCAGAAAAGACACGC
AGGTGAAGTTTCATGGACAGAGACTTGAGTTGGGCGAGATAGAAAACCAGCTGGCTGCCGACCCAATTGTCAAAC
ACTGTCTAGCTTTTCTTTCGAAGTCAGGGTTCTCTGCAGGCAAATTGGTGGCGGTAATATCCTTATCTGTTCACT
TCGAATCTCAACCGGAATCAAATGCAGCGCCACTCAAGCTCCTTGATACATCGAAGAAGACCTCTATCGTTGCAG
AAGTTCGCGAGAGATTATCAGCTAAACTACCAACCTACATGATACCCTCCGTTTGGCTGTGTGTGGAGGCATTGC
CGTTGCTTCCGTCTGGGAAGCTGGACAGAAAGGCGACCGCAAGATGGATTGGAGATATGGAGCGAGACCCGTATG
CCCAAGCTATAAGCGCCAGGACTTTGTCTGCGGATAAAGCCACACTTCCTTCGAGTGCCACGGAGGACAAACTCG
CTGCGATCTGGAGCCGGGTTCTCAATATCCCCCGAAGCCAACTTGCCCTTGACGAAGGCTTTTTGAGTCTAGGTG
GAGACTCTATTGCCGCCATAACGTGCCTCGGGTATTGCAAGAAGCAAGGAATGGGCTTGACGGTACAAGAGGTGC
TTCATAGCAAGTCAATCAAGGAGCTGGCTACTCGGGTAAAACAGATCGATCAATTTGTTGTGTACGAAGAAAAGA
TCGATGAGCCCTTTGACCTTTCACCAATCCAGAAGCTTCACTTCATGGTCCGAAACGAGGGCCAAGGCCACTTCA
ACCAAAGCATTCTTACACGCCTGAACCGGCACATTGATGAGCATAGCATGCGACGTGCAATTGAGACCATTATCA
ATCGTCACTCTATGCTCCGCGCTCGCCTGGTCGAATCAGACGTTGAGGGGATAATGCGGCAAAGAATAACTCAAG
ACGTAGCAGGGTCTTACCGTTGGCGTTCTCACAACAACAGCAACCGAAGCGAGGTCGACCATGCTATCTCGAACA
GCCAGTCATGCATCAATGCCTTCGTTGGCCCCGTACTTGCAATAGATGTCTTCTATGGAAATGACCATTCCCGCC
TGCTGTCACTCGTGGCTCATCATATGGTAGTCGACATTGTTTCGTGGAGGATTATTTTGGAAGACTTGGAAGACC
TACTGATGAACCCCGATCAACCGATATCACAGAACGGCTCCCTTCCGTTTCAGAACTGGTGCCAAATTCAAGCAG
ATCGTTGTCAAGAAGCGACAGCTGAACGAACCATGGATCTGCCTGAAGTTCCCGCACCCGATTTTGCCTACTGGG
GACTAAAAAGCCACCAAACCACCTATGGCGATGTGGATTGTGAAACGTTCGATCTTGACAGTGATATTACTCGCC
ACATACTGACTGGGTGCCACGAAAGTCTTCAAACAGAGCCAATCGATCTTTTTCTAGCAGCTTTGCTACACTCCT
TCGGCGAAACGTTCAAAGACCGATCATTGCCAGTTATATACAATGAGGGACATGGGCGAGAAGTCTGGGACTCAT
CAATAGATATCTCTCGCACTATCGGCTGGTTTACCACACTGTATCCCATTCTTCTATCGGAACTTCCTGCAAAAG
ATCCAACCGAAACGGTTGTACGTGTTAAGGATTTGCGACGTTGTGTTCCGGACAATGGTCGACATGATTTCGCTC
GTCGTATGTTGGTTCCACGCGAAGATGGGACTTGTCGGCACTATAGCCCCATGGAGATGTCTTTCAACTATGTGG
GCCAGCACCGTGACCTACAGAGAAAGGATGGGCTCTTCCAACTCATGGATCAGATGGCTGGAGAAACAGGCCGCG
GAGGTGCAGCGGCTGATTTTGGTGAAGAAACTCCTCGCTTTGCACTGTTCGAGATATCTGCGATGGTTGTGCAGG
GTCAACTTCGCTTTATCTTCTCCTTCAATAGGAATATGCAGCATCAGAATGGTATCCGTAACTGGGTACACTGCT
GCAAAACATTACTGGCATCCCTGGGCGAACGCTTACAGGCTCTCCCACCGAAACCAACGCTAAGCAGTTTCCCCA
TGTTAACATTGACATATACCGAACTCGATGCGTTGGTGTCGAAAAAATTACCGGATGCCGGTATTCATAGTCTTG
ATGATGTTGAGGACATCTATCCTTGCTCCAGAATGCAGCAGGGCATTCTACTCAGTCGCTCTCGCGATAGCTCAC
TTTATGCTGTACATGACACATTCGAAATATCCGGGCCAGGAAGCACACCCGACATCAACCGATTGATACTTGCCT
GGCAGAAAGTCGTTGCTCACCATGCAATGCTACGGACTATATTTCTGGAGGGGTTGAGCAGCCACGACCTACATT
GTCAAGTGGTGCTCAAATCGTTCGATTCCCGCCCAACTTACGTCGTATGTGCGAATGAAAGCGAAGTGCTACCTA
CATTTGACAAACAGCAACCGATGAGCTACGATAATAATATACCTCCTCATCGGCTTACAATCTGCCAAACGGCTT
CTGGGAAGCTGTTTTGTCGACTGGAGCTGAACCATGTCGCCATGGATGGCGCATCAATCTCCATCATCCTTCGGG
ATCTGCAATTAGCGTACCAAGGAAAGCTCGAAGAACCAAAGCCGAAGTTCAAAGAGTATATACGCTACCTTCGTG
AGGTTCCCCAAGTCGCAAGTCTTGACTATTGGCGCAATTATTTGTTGGATGTCCAACCTTGTCATTTCCCCGTGC
TCAATGACGGCAAAGGCTCTGTAAGGCAGCTTCGGACCAAGAGATTGGGCGGTGTGCCATTCAAAGAGCTACGAA
CCATCTGCGATATGAATGGTCTGACCCTTCCGACTGCCTTTAGTGCTGCATGGGGATTAACGGTTCGCTCCTTTT
GTGGATCAGATGACATCTCCTTCACCTATCTTGCATCACTAAGAGATGTCCCAGTAGAGGGCGTTGAATATGTTG
TTGGACCTGTCATCAATACCCTGACCTGTCGTATGCTGTTTGCTAAAGGGACGTCACTGAAGGAGATCCTCGCAA
AAGTTCAACAGGATAACCTGGACAATTTGCCGCACAGGCATATCTCACTCACGGAGATCCAGCAAGCTTTGGGAC
TAACAGCCTCATTGGCTAATAGTGGTATTTCTTACCGGAAGCTTCCCAATCAGAATGCTTTGTCAAGCGAGGAGA
TACAGTTCTCTGAAGTGGGGACAATTCACGACCCGGCAGAGTCGCCCGTTTTTGTCAATGTTGAAGCTACAGAAG
ACGACGCACGTATCGACCTTAACTACTGGACAGACCACCTGTCGGACGGGCAAGCAGAGAATGTCGCGAGCACAT
TCCTTAAATCGGTTGAAAATATTGTGCACCACTTTGAGGATGACGCCCATTCAATTGACAACTTTAGCGACGCGA
ACAGACAAAGCCTAATGCTTTGGAATAGCGAAGTCCCAAAGTCCATCGACAAATGCATGCATGAGATAGTTGATG
AGTGTGCGAAATCCCACCCTCACACCATGGCAATTTCTGCTTGGGATGGAAACCTCACTTATGCTAAGCTCAATG
AATTGTCATCGCTACTTGCAACGTACTTGACAACACTAGGGGTGGGCCCCGGAACAATCGTGCCCCTTGATCTCG
CTAGATCCTCCTGGCAAGTTGTAGCCATCTTGGCAGTCATGAAGACAGGTGGTGTATGTGTTCCGGTGAACCCAG
CCCGACTGCCACAACATTTCGAGACTTGGCTCGTCGACAATGAGATCCAGGTTGCCCTAGCATCACCGACTCAAA
TGCAACTACTCGAAGGGGCCGTTCCATATGTAATTTCCGTGGAGAGCTCTCTGTTTGAATACCTTTCAGACAGTG
ATGCAGTTTCAAGCTCACCAATTCAGCCATGCAGCGATGCATATATCGTGTTCGGCGCTGAGAGTCCCAAGTGCA
TCTTGATTGACCATCGTGCAATAACAACCCGGGCAAGCGCGTTCGCTTCAGGTCTTGGACTAAATGCACGAACAA
AGATGCTCCAATACGCTCCATATACTTCTGACATGTTCCTTCAAGAAGTCTTCGGCACGTTCCTGTGCGGTGGGT
CTATCTGCATTCCGTCAGATGAAGACCTGGCAGACCTGTCAAAAACCATCAAGACAATGCAGGCGAACTGTGTCA
GTATCACACCCTCAACGGCGATGACTCTAAGATCCGCAGAGGATCTGGGGATAGAGGTCCTTGCTTTATGGGGTG
AACACCCGACCAAGCAACTTCTTACCGCCTTGCCTGGAGGAATCCAAGTGCATGCATTCTATGGAACGCCAGAAT
GCTCATCTTCTTGCATTCGATCCTCTCAGCTTGACGGATCATGCGAATCGTCAATTATTGGGTCAAGTCTTGGAT
GTAAATCTTGGCTTGTAGATCCCTCCGATCACGATATTTTGGTTCCGATCGGCTGCGTTGGCGAACTGATGATAG
AAGGCCCAAGTCTTTCTCATGGTTACTATCAAGATGCGGAACTCACGCAACAATATTTCGTCGAAAATCCCTTGT
GGAGACTGGCTTACGAATCCCAGCCATCATCAGACAAAGACAAGAACACGGACGCCCAGAAGCTGTCCTATCGAT
TGTTCAAGACTGGAGATCTTGCTCGCTACAACTCCGATGGCACACTCGTTTACGTTGGTAAGAAAAATAGAGGGT
TGCATTGGCAGCGACAGACAGCGGCCATTTACGTCGAAGAGCAAATCGCATCTCTCTCATCCTTCAATGCCCAGT
ATGTCGTTGAGGAGATCAGCAAGAGCAATGTCGATTCTCCCCGATCGTCTCTGGCCATCTTTTTCTCTGATGAGG
CCGTCGACTCCAAGGGACACCACCAGCCTATTGCACAATTGTCACCTGAGCTGCACGACACAATGATCAGGCTGT
ATAAAAAGCTGTCGAGCTCCTTGCCAGCGAATTCTGTCCCGAGACTGTATTTTCCGACGTCTAGCATACCACTGA
ACTCGTTCGGTAAGCTGGACCGCCAGCTGCTGAGAAATGCGGCTCAAAATCTGCCAGAAGAATTGCTGTCTAGAT
TCGACATCAAAAGCTTTGACAGCTTCTGGAAAGGGCAGCTGGCCACATTGGCGCTTTCGCCAGTGTTCCCGTCAC
CCCGTGGCTCTTCGTCTCAGCGGAGCACACCGGTCACCAAGCAAGCAACAAAAAACATGCAGATGGTCTGGTGTG
ATACACTCAGATCAATGACCGAAGGTACACGATGTGCTATCCTTTCTGCATGGGCTCTTACTATTCGCGGCTACA
TCAGCTCCCGTGATATTGTTTTTGGGGAGTTGCTGTCAGAAGTTGAATTGGCCTCCACTGAGCGTCAGGACAATT
ATACGCAAGCTGCAACTATCGTTCCCCGACGCTTCCAACTCAACGATGATTGGACCATTACTGAGTTACTGAGCA
GGGTAAAGTATCAACTGGAGTCAGCTAAGCCCTACCAATGGGCTGGAATAAGTCAAATTCAGAAATTGAACGCTG
ATACGGCGCGCGCCTGTGATTTCATGAACTTGATCTCTATAACGGACAATCGTGGCCTTGAACCAAGACTAGTAC
CCATGAAACAGCATGACAGCAATCTTTCCGGTTATCCTTTGATGGTTGATTGTATCCTTGGAGATGCTACGCTCG
AACTCTTGATTAGTTACAATGACAGCACTTTAACAGGCACCCAGATCGAGCGACTGGCTGCCCAATTCTTCGCTT
GTGTTGGACTTCTTAACTCCAAGGCTAGCATGAACAAGACAATCGGTGTCTTGTCCAGAGACAACATGGACTTTT
GCTCCTTCCGCCATGATGTTGCCTACTGGAAAAACTATTTGGAGGATGTTGAAGCTTGTCTTTTCCCGGCACTAC
GTGCAAGTGCGGAGGAAAATACTCATGCTGAGACCCAGATAATACTCCAGAACACCAAGCATCTACATGATCTCA
GTGAACGTGAACGTCTCAGCAAAAGCTCGCTTCTTCAGCTTGTTTGGGGCTTGGTTCTGCGATGCTACACAGGCC
TACAAGATGTGTGCTTCGGATATCACATTCCAGATGCAAGCGACAGATCTGCCAAGCCTGGAGTTGCGAATAAGC
CAGATATTTCAGGTACATTCCCGTGCAGAATGCTCTTGAATGGTGAATCTAGGGTTGCGGAAATTTTGAGAGAGC
GACTGCAAGGACTGAATCAAATGCAGCAGCATCGGTTGCCGTGGGATGAAGTCCAGCAAGAGCTTGGGTGTAGCG
ACATTTTCAATACCGTTTTCACTTGTTCAGAACAATCAAGTGACGCAGTAAATGTGGCTGGTCTCGCTGATCTTG
ATCCGAGCAAATACCTGATTACCGTCAACGCCACTCTAGCAGAATCATCAGGAGTCATTAGGTTCGGCTATCAAA
GGAGGCACTTCTCAGAAACCGACATGGAAGGCGTCCTTGATTGTTTTAATAATATTCTGGGACAGTTACTCCAAT
TCCCTCTTCCGGATCTTTTGGTAGGCGAGGTTGACTTTGTGAGTGAGCTTTCCTGCCAGAAGATATCTGAGTGGA
ACTCGGCGCTGCCAGACCGTCCAGTGCTATGCGCGCATGAGCTCATCCAACAGCAAGCTTTGGATCGTGCTTCGG
CTCCTGCAATTTGTTCTTGGGATGGCAACTTCACATATGCACAACTTGACCGATTGTCGACTCTCCTAGCAAACC
AGCTGGTGGGCTTAGGGGTCAAGCCCGACATCTTCGTTGCATTGTGTTTTGAAAAGTCCGCATGGGCGGTTGTTG
CACAGGTTGCTGTTTTGAAAGCTGGAGGAGCCTTCGCTTCATTAGATCCAGCTCACCCAGAAAGCCGCCTACAAG
GCATGATCGATGATCTTGGCGCTCAGGTTATTCTTTGTTCTGAGACACACTACGAGAGAGCCTCCAGCATCTGTC
GTCGCGCAATGATCGTAAGCAATAGCGCACTTGAACAACTTCACCACTCACCCTTTGCTGCTCCGACCCAAGAGG
TAACCGCTGATAACGCAGCCTACGCCATATTCACATCGGGAACCACAGGGAAACCCAAGGTGACAGTACTTGAGC
ATGTTGGACTTACCCTAGCCTGCACAGAGCTCTCCAGGGCCTTCTTCATAAGTTCAGAAACACGCGCTCTGCAGT
TCTCAAGCTATACATTCGACGTCAGCATATTGGAAACTATAATAGTCCTTGCTGCTGGTGGCTGCATTTGTATCC
CTAGCGAAGATGAGCGCATGAACAATCTTTCTGGAGCCATCAGAAAGATGAACGTCAACTTCATGAGCTGTACTC
CATCTATCGTTAATACCATGGACCCCAATGCTGTTCCTTCATTGCGAACAATAACTCTCGGAGGAGAAAAAATGA
CTGCAAGCCATTTCGAGCGATGGGCTGACAGGTGTGTTATTAACGCGTACGGTCCGTCAGAGGCTACTGTCGCCT
TTACGTCAAGCACGAAATACGACCATGCAGGAGTACGCCTTACTGATGACTATGGTTCTATTGGCACTGCTATTT
GTGGCAGGACATGGATTGTTGATCCCCAAAATCACAATCGACTTGTGCCCATCGGCGCACCCGGAGAGCTCGTTC
TTGAGAGTTGCACTGTTGCTCGTGGGTATCTCAATAATGACGAGAAAACCAAGGCTGTTTTCATCCGGGACCCGG
AGTGGACTCAGCGTGAAGGGCTACAGCATGTGTTGAGGCGCAAAGAACGGATGTATCGCACGGGAGATTTAGTGC
GCTACAACTCCGACGGCTCGATTGCTTTCATTTCGCGAATTGATACACAAGTGAAATTGAACGGTGTGCGCATCG
AATTGGAAGAAGTTGAGCAACAATGCAACAACTATCTTTCGACAGATACTCAGGTTGCCGTTGAGGTTGTTACTC
CAGAGGCCAAAACTATATCAAAATGCTTGGCTGTCTTCTTCACCATTGACGAGCATCAAATGAAAGATATGGCGA
ATGGTGAATTCATTTTGCCCATGTCAGAGTCTGTAGTTCACATGGTCAAGAAGCTACACGGTTCCCTAAGCGCTT
CATTACCGCTAGCTATGGTGCCCAAGCTTTACTTCCCCATGCGGCGCCTGCCGTTTGGAAGCACTGGCAAAACTG
ATCGCAAAGCACTTCGAGCAATGGTCGATACATTTACCAAGGAACGCTTGAGACCATATGTTATCTTCAATGTTG
GCGCAGAAGAACGCTCCGATGTGGGAACGGAAGGGACAGATAGCGTTCTCAAGACGCTATGGGAGGAAGTCCTTA
ACCTTGCGCCAGGTTCTATCAGTGCCGAAGACAACTTCTTCGGCATGGGTGGCGACTCGTTTTCTGCTATGAAAT
TAGTCGTAGCCGCGGCATCCCAGAATATTTCACTTGCAGTGGCCGACATATACCGAACTCCTATTTTCAAAGACA
TGGCAAAGAGATGTGGAGCGGGTGAGGTTAAGACTGGTGTACCAACAGTGGACCCTTTCAGCATGCTGCCTGAAT
CTCTTCCACGCGATGATATTCTGGAGGAAGTCTCTGACCAATGTGGTGTGCCTATGGATCGAATTGCGGACATCT
ACCCGTGTAGTCCGGTGCAAGAGGGTTTGCTCACACTTTCTATCAAGCAACCCGGAGCCTATGTCGCTCGACCTG
TGTTCCAACTCGCAGAGGGAGCTGACCTTGACAAGTTTAAAGCTGCTTGGCAAAAGGTGGTTAATGAAATGGATA
TTCTTCGGACTCGGGTAGTACACACCGAGTCCGCCAACTTTGTCCAGGCAGTGCTCACTGATGTCCCTATCCTCT
GGGAAACGGCAACGGAATTGGACGATTTAGCAAACGACACTATTGACCTAGCCAAGAATAACGGGGGCTTGCTAA
CTGGATACGCCATTGTCGAGTCCGGACACTCGCGCTCCTTCGTTTGGACCATACACCACGCTCTCTATGATGGAT
GGAGTGTGTCCCAGATCCTTCAAAGAGTTGAGGAGATATACTCGGGTGCTTCAAAACTTAGCTCGACGCTTCCTT
ATAAGCTCTTTATCAATCACCTGGTCCAGCAAGAGGCTCATTCCTCGGACGAATTCTGGAAGACGCACCTCGCGG
CCCTGTCTTCATGTCCTTTCCCCCAGAACAAGCCGTCACCTGATACCATTCGCGTCGGCAATCGGCATTACAGCT
CGCTTGAGATTTCTCGTGCATCAAGTGGGCCTAAGTTAACCGTTCCTGAAATGATACGAGCTGCATGGGCACTAA
TTGTATCCGTCCACACCGGTTCCGGAGATGTCTGCTTCGCTGAAACCCTAATGGGTAGAAATATTGATATGCCTG
GGGCTATGGAAGTTGCAGGACCTCTTTTGACCACGGTTCCTATACGGATGGCTGTCAACAACGAGCTCTCGATTA
TCCAGTACCTCGATAATGTGCGCCAGCTGACCACAATGATGCTCCCGCATCAACATTCTGGGCTCCAGAGGATCC
GCAAGCTAAGCAGCGACACTGCCCTTGCTTGCGAATCCCAAAATCTACTGGTTATTCAATCAGAACAGGCCCATT
CGAACACAAGTATCTGGGAGCAAAAGGATAACCTGACTGAAGGCGAATTTTTCACCCACCCAATTGTTGTCGAAT
GCAAGGTTGGCGAATCGCAGGTGGCCGTAACCCTTCATCACGATGAGCTTGTTTTCGACAGTTGGCAGGCTAAGA
TGCTCATTGAACAGTTTACCTTCGTTTTGAGTCAACTGTTATCAATCTCCAATGAAGAATCCAGAAAGATCGGAG
AGCTAGAGGTTTCCAGTTCTCGGGATAAGGAAGAAATTGCTCTCTGGAATGAGAGAAACCTGACTTGCATAGACA
GATGTGTTCATCATATCATTGAGGAGAAAGCATCCCTCCGACCTCAAGCTCAAGCCGTCTGCTCCTGGGATGGAC
AACTAACTTACCAGGAGCTTTACCAGCTTGCTTCTTCGTTTGCAGCTTACCTGAAAACTCGTGGCGTAGGTCCGG
AGACTTTGGTTCCGATCTGTATGGACAAGTCTTTGTGGGCCATTGTCACAATACTGGGTGTCCTCATTGCGGGTG
GAGGATATGTCCCCCTTGACCCTGCTCACCCAACGTCAAGACACAAGGAAATTCTGACTGAGGTCGAAGCCCGTG
TCGTTCTCTGTTCTCCCAAGTATCAAAGTCGGTACACTGGCTCTGTGAAAGCAATCATCCCTGTCAGCAAAGAGA
CGATCAAGGCGTATTGTGCTCTTAGAACGGCAACTGCTAAGACTACTAACAACGCTACACCCGAAAACGTTGCAT
TCGCTATCTTTACCTCTGGCAGCACTGGTCGTGCTAAGGGTATTATCATCAACCACAAGGCACTTGCCAGCAGCG
GCATGGCATTCGGGCCCATGGTGCACCTTGACGAGAATTCTCGAGCTTTCCAATTTGCCTCTCTTACTTTCGATG
CTGCTGTCATGGAAACACTCGTCACCTTGATGCACGGCGGTTGCGTGTGCATTCCAAGCGAAGATGAACGCTTGA
ATGATGTTGCTGGCGCTATTCGTCGGATGAATGTCTCTTGGTCATTCCTGACTCCATCCATAGCCAGTATCATTG
AACCGTCATCCGTTCCATCTCTGAGGGACCTTGTGTGTGGTGGAGAGAAGATGTCTCGCGAAGTCATCACCAAAT
GGGCACATCGGGTAAACCTGATGAATGGATATGGTCCAACTGAAACTACTATCTTCGCGGTTATCAACACAGATG
TTGCTGCCAACCCGGATCCCGCCTGCATCGGCCATGGCATTCCTTGCACCCTAACCTGGGTTGTCGATCCTGATG
ACCACAACAAACTAACTCCTCTAGGGGCTGTTGGTGAGCTGGCACTGGAAGGCCCCGCACTTGCTAGGGAATACC
TCAAGAACCCTAAGAAGACAGCAGAGGCTTTTGTGGATGAGCCGGAGTGGATTAAGGCCTTCCCTAGTGTCCTAC
CTTCGCCCAGAAGAATATACAAGACTGGAGATCTTGTCAGATACAACTCTGACGGTTCCATTCAATACATCAGCC
GCAAGGACCATCAAGTCAAGCTTCACGGGCAGCGCATGGAGCTTGGAGAGATTGAGCACAGACTATATGAGGACC
CGCGAGTCCGCCACGCTGTGGTCTTACTGCCAACGGCAGGTCCCCTCAAACAGAGGTTGGTCACTGTTCTTTCAC
TGAATTCTGTAACTGCGGAGAAAAGCATCATATCAGACAATGCATGTGAACTTGTCGATCGGGGTGGATCTGCAC
GGGCAGCATACCAGGAGCTCGTTGCTATCCAGAAGAGCTTAGAGACACAGCTACCAATCTATATGGTTCCACAGG
CTTGGGCTCTGATCAAGCAGCTCCCAATGCTCGTGTCTGGCAAGCTAGACAGGAAGCGAATCACAGCTTGGCTGG
AGAACGTTGATGATGCTGCTTATGATCGCATAATGGAGGATTACGACAACATAAAACGTGGGGATGTCGAGCAAG
ACGAGGAGAAAGAGGATGACCGAGAGACTTCTGTCAAGCTTCTTCAGGAAGTCTTTTCCCAGGTTCTCAACTTAC
CATCTCACAAGGTGGGCTTGGACAAGTCATTTGTGAGCCTAGGTAAGCAAAGCCAGAATGGTAACGGAGTGTGGA
GAGTTGCTAATAGTGCGGTGCAGGTGGTGATAGTATCACTGGAATGGCTGTCATTTCTCGAGCGCGTAAACATGG
ACTCACGCTGACCCTCCACAATGTGCTTCAGTCGAAGTCGATAAAGGAGCTTTCTCTAGCTGCTCAGACAAGCGT
CAAGACAGTGAAAAGAGAGGAGAAGCCTCATGAATACTTCGAACTGTCTCCGATCCAGGGATTGTTCGTTCAAAC
AACAACAAATTTTCGGGATTCTTCTCGCTTTAACCAAAGCATGACAGTTCGCGTTACTCGAAGGGTCGAGCCAAC
TAGAATGCAAAGCGCCATTAAGGCTGTTGTTGAACAGCACTCCATGTTCCGAGCACGGTTCTTCAAGTCTCGCGA
CGGAAAGTGGAAGCAGAAGATCAGTGATGTATGTATAGCTTCTCCCTCGCTAACTCTGTTTGGGTACCGGAAGCT
TACTGATTTAGGATGTTGATGCCTCATACCGCTTCCGTCATCATATGGTGGAAAATAAAGATGCAATTCTCCCCA
AGATCGCCGAGTGTCAACGGTCTGTAGATGCTCAACATGGACCCATCGTTGCTGCAGACATGGTCCAAGTACGCA
ACGGCATCACAATACTTTTCCTAGTGGCCAGTCATCTATGTGTTGACATGGTATCCTGGCGTATTGTCCTCCAGG
ACATCCAAGATTTCCTCGATGCTGGATCATTGTGCCCAGAGAAGCCCCTGTCATTCCAAGCTTGGTGCAACCTTC
AGCTTGAACAGAGCAAGAAACCAAATGGCAGAGTCCAGCTGCCTTTTTCTATTCAGCCTCCTGACCTGAAATACT
GGGGCATGGAGCAGTCCCAGAATCTCTATGGGGATGTCAAGATGGAAGGGTTCACGCTTGATGCCGCAGTCACGA
CACAAATCCTCGCAGCCTGCAATAAGGTTCTACGCACCGAGGCTATTGAAGTCATACTCTCCGCTGTTATTCACT
CTTTCCGTCGCACGTTTACTGATAGAGAAATGCCGACTATTTACAACGAGGGCCACGGTCGCGAGGCGTGGGACA
GCTCTATCGATCTCTCAAGAACGGTGGGCTGGTTCACGACTATGTGTCCACTGCATGTTGGTGAAGGGTCGGGTA
AGTCTAATTCTAGCCTATCAACGGAGCAATTCCTGACTGCTATAGATCTACTTGACACTTTGAAGCGTGTCAAAG
ACACAAGGCGTCACCTCAGCAGTAAGAGCCGGTCATACTTTGCGGAAAGCCTGCTTCAGCCGGAAGGTAAAGAGG
GCGATGCTTTCCCTGTCCCGCTCGAGATTCTGTTCAACTACCTTGGCCAGCTGCAACAGCTAGAGCGCGATGATT
CGCTTTTCCAACATTATGGTGAAGCCTTCAACGCGGAGACCTTCGAGATGACAGGGGACATGGGCTCAAAGACAC
CTCGGTTTGCTCTCTTCGAGATCTCGGCGCTTATTATCAAGAACAAGCTTCAGGTATCGTTCACTTACAATAAGC
ACATGCAGAAAGAACAGCGGATCAAGGGCTGGATATCTGAGTGTAAACGAGTGCTGGAGCATATGTCTCGTTTCG
AGAGCTTCACGTCTGAGCCGACACTCAGCGATTGTCCCTTGCTCCCCATCACTTACGAAGGCCTGAACAACATGG
TCAAGAGAGCATTCCCCAAGATCGGAATTGATAGCTGGGATCAGGTTGAGGAGGTTTATCCCTGCTCCCCAGTAC
AAGAAGGTATCCTTCTTAGTCAGCTTCGAGACCCGGAGGAATACCTGTTCCATGTCATCTTCGAAGTGCACCCAT
CCAAGGGTAGCAAGGTGGATACAAGCAAGCTTCGAAAGGCATGGTCCATGGTTGTCAGCAGGCACCCTATCTTAC
GGTCTGTCTTCATTGACAGCAACTACAAAGGCGGATCTTTCGACCAGGTAGTGGTCAAGTCACTCGACGATGAGG
TCATTGAGTTCCAGTGCCCTGAGTCGGATGCATTGGGTACACTTGGGGAAATAAAGCTGCGCGATATCAATGCTG
AGAGATCGATGAAGCTCGCCCACCAGATGACCCTCTGCAAAACAACTTCTGGGCGAGTCCTGTTCAAGATTGAGA
TGAACCATGCCATTATCGATGGCGGGTCGGTTGACCTGCTTCTTCGGGATCTCGCCCTCGCATACAGTGATCAGC
TTTCTGCCGGAACCGGTCCACGCTTTAGTGATTATGTCAAGTATATCAGGGAACAATCCCAGGGAGAAGCTGTGG
CACACTGGGTGAAGTATCTCTCTGGCGTACGACCTTGTCACCTCCTGGTATCTTCCAAAAAGAGCGGTAGCCACC
AGCTCGGCGAGCGCATGATATCTTTCAAGCGCTTTTCTGAGTTGCAAAGATTCTGCGAGGAAAATTCCGTCACAC
TCGCCAACTTGACCCTCTGTGCCTGGGCAATTGTACTCCGGAATTGTACAGGATCTGATGATGTCTGCTTCGGAT
ATCCGTCTGCTGGTCGTGACTCCCCTGTTCCTGGGATCCAAGATGCGGTCGGTATCTTCATCAACATGTTGTGCT
GTAGAGTCAAGTTCTCTCCCGGACAAACACTTCTTGAGATTGCCAAGAAGGTACAGGATGACTTTGTCAGGAATG
TGCCGCATCAGCACTGCTCTCTGGCTCAGATCCAGCATGAGCTTGGAATGCATGGAGAGACGCTCTTCAACTCAA
CTCTTTCCATTCAGAGTCGCTCTGCCAACAAAGGCACTGGAAATTTGCCGCTCGACTTCGACGCCCAAAAGGCCC
ATGACCCAACTGAGGTGAGTTGATACCGTCTCGAGCGTAGACGCGAGCTAACCATTGATTTAGTATCCTGTTACT
GTAAATGTGGAGACTACCAAGGGCAAGGAGGGAGTTTTGCTGAGGTACTGGAGCAACGCAGTGACCGAAGCACAA
GCAAAGGAGCTAGCGGAAGCTGTTACCAAGGTCTTCACATGCTTCATCGAGGAGCCATCCAAGCCGGTATCGAGC
TTGAACCTCCTTAACAAGCTACCGCGGAACCGTTCGCAGCACACCCACAGAGAGCCCCTCATTTTGGACCAATTG
ATTGACAGTCAGGTCCTACAGAAGCTAATTGACGATCGCGTGAATGAGATAATCAGCCAGATGCTGAAGGAAGGC
AAGCTCGCCATACCCCTTCCTGATCAGAAGACTAGATACTCGAACAGCTCTGTTCAACTCAAGATGGTCGAGGCT
TCGCTCCAGAAGGATCCCATAATAGACGAAAAGGATCTTGCAAACTCAACACCATCCCTAACAGATGATGGCAGA
AGCTCAAGTGACAATGATAGGCGCCTTTGGGACCTGTGGAAGTCGACATTAGGGCTATCTTCAGACACTATCCAA
TACCGGAGTAGCTTTTTCAAGCTAGGCGGTGATAGTATTACAGCAATGAAGATGGTCAGCGCTGCACGAGAAGAG
GGCTTGCAAATGACAGTGGCGGATGTGTTCAACAACCCGATCTTCGAGGACATGCTGGCTACGATTACTCCGAGC
AGCAGCCCGACCTCAAACGCCGATACCCAGTGCGCAAACAACATTGAAAAACTCCTGGAGGTTGATGATGCTCTC
CCAGATGCTACCCCACCGCAGGATATCTCGGTGCTTAGGCCAATGCAGCTCGATGCCATGTCTCTGCTTGATGTC
ATCTGCCCTAAGATAGGGGTGTTCAAAGGAGGAATTGCTGATGTTCTCCCTGTTACGGACTTCCAATCCATGTCG
ATCGCTGCCACGCTCTTCGGATCGAGGTGGATGCTGAACTATTTCTTCCTCGATGGAAGTGGTCCTCTAGACCTT
CGACGACTGAGGGAAAGCTTCTTGAGGGTGGTCGATGCTTTCGATATCCTTCGGACTGTTTTTGTCTGCCACCAC
GGGCAGTTCTTCCAGGTGGTGCTGAGAAAAGTCCGACCGGATATTTTTGTGCATGAGACGGAGCAGAGTCTAGAT
GAGTACACCAACGGCTTACAAAAACGGGACCGTGAACAAGATCCACGCCAAGGTGAGCAGTATGTGCAGTTCTAC
GTTGTCAAGAAAAAGAATAGCGACCAGCATCGCATCTTGATCAGGATGTCGCATGCCCAATTCGACGGCGTTTGT
CTGCCAAAAATTATGAACGCAATCAAGCTGGGATACGAGGGCAGCACCCTACCTCCAGTCTTCTCCTTTTCGAAC
TATATGCGGATGCTTCCTGGAAACATCACCCCGGCACACTACCACCACTGGTCAACAATACTCAAGGGCTCTAAG
ATGACCGATATCATTCGGCGCACGCAGCCTAATACCTTCATGCATATTGGTGCTTTCGCTGAGCAGAAGAAGACG
ATAATGATACCCTCAACCGCCATAGGAAATGTCACCCTCGCGACCGTTATGCAGTCCGCATGGGCGGTGACTTTG
GCAAAACTGACTGCCCAGTCGGACGTGGTCTTCGGGCTTACAGTCAACGGCCGTAACGCCAGTGTTCCTGGTATT
GAGACCACTGTTGGGCCCTGTCTTAACATTCTTCCCATTAGGGTTAAATTCAGGGAGCATTGGACTGGCCTTGAC
CTCTTCCGTTATCTCCAAGATCAACAGATCGCCAACATGCCCTATGAGTCGCTAGGATTCAGGGAGATTATCCGG
AACTGCACCGATTGGCCCGACTCCACATACTTCACCACCTCCGTGTTTCATCAGAATGTCGAGTATGAGGGACAG
ATGCATCTAGACGGCAATTCGTACCGGATGGGAGGCGTTGGTGTTTTGGACAACTTCACTGATCTCACGCTGGCC
TCCAAGTCCTGTGGTCAAGAGAAGCTCGATGTCTCAATCGGGTACTCGCTCAAGGGCCCCATTCCAGCAACCTTC
ATCGCTAAAGCCCTTAACATGGTTTGCGAGACTGTGCAGAGCCTGATTGCCAACCCCAGCGTCCCACTTGCGTCC
CCTGCCACTATCCGCTCCCTGCCTAGCCAGATCATTCGTGAAACACCCAGAGCATCTGATACACCCTTCCTCTCG
TCAAATCTAAACAGCCAGAAGATGTCGGAGATTGTAATTCACTCAGATATCCTTACCCGGTCCTGGCAGCAGGTG
CTACCCCGTCAGACTGACAACCCACAATACCAACTCGATGCATCTTTCTTCGACCTGGGCGGAGACATCATGAAT
GTTGCCCAACTGGTCTGGATTCTGGGAGAAGAAGGCTTCAGTGTCCGTTTGGAAGACCTTCTCGAGCACCATACG
TTCCTGGGAATGATGGCCGTGATGGCGATGCACCACAAGCCGGAACTGAATGCCAGAATGGCAGCGACCATGGCT
GAAGAACCAGCCAAGGAAATGAGAATGACTATGACAAAGAGCAACAGCTGGAGCTCGCTGGGCAAAGCGATGACG
CTTGCTAAGAGATTTACTAGATGGGGGGCTGTAGCAGCCAAAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail