Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g1643.t1
Gene name
Locationscaffold_006:206176..206890
Strand+
Gene length (bp)714
Transcript length (bp)564
Coding sequence length (bp)564
Protein length (aa) 188

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC) 4.4E-11 52 182

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0006801 superoxide metabolic process Yes
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:0072593 reactive oxygen species metabolic process No
GO:0005488 binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g1643.t1
MLFKSTFLATATALCLSATATAQGASTNAPVVTDNDDVLYYAQLQPKDNTTVRGSVTIFPKPDSVGVLVSAQFWG
IPDNDQQLVYHIHQKPVPQDGNCYSTGAHLDPYGRGDATPCDINAPQTCQVGDLSGKHGPIWAPDNEVFSTTYTD
WFLSNVEGEPAFFGNLSLVVHAADNSRLACGNFVQLK*
Coding >Ani_SJS100_1|g1643.t1
ATGCTTTTCAAATCCACCTTCCTCGCAACTGCCACGGCTCTGTGCCTCTCCGCCACGGCTACAGCTCAGGGCGCC
AGCACCAATGCCCCCGTCGTCACAGACAATGATGATGTCCTCTACTACGCCCAGCTCCAGCCCAAGGATAACACC
ACAGTCCGCGGGTCTGTAACCATCTTCCCTAAGCCCGATAGTGTGGGTGTCCTTGTTTCGGCGCAGTTCTGGGGC
ATCCCCGACAATGACCAGCAGTTGGTCTACCACATCCACCAAAAGCCAGTCCCTCAGGACGGAAACTGCTACAGC
ACCGGTGCACACCTGGACCCTTACGGCCGGGGCGATGCCACCCCCTGCGACATCAACGCGCCACAGACCTGTCAA
GTTGGCGACCTCAGTGGCAAGCATGGACCGATCTGGGCGCCCGACAACGAGGTATTCTCCACCACGTATACGGAC
TGGTTCCTTTCCAATGTGGAGGGGGAGCCTGCCTTCTTTGGAAACCTCTCGTTGGTCGTGCATGCAGCGGATAAC
TCGCGCCTGGCGTGTGGAAACTTCGTGCAGCTGAAGTAA
Transcript >Ani_SJS100_1|g1643.t1
ATGCTTTTCAAATCCACCTTCCTCGCAACTGCCACGGCTCTGTGCCTCTCCGCCACGGCTACAGCTCAGGGCGCC
AGCACCAATGCCCCCGTCGTCACAGACAATGATGATGTCCTCTACTACGCCCAGCTCCAGCCCAAGGATAACACC
ACAGTCCGCGGGTCTGTAACCATCTTCCCTAAGCCCGATAGTGTGGGTGTCCTTGTTTCGGCGCAGTTCTGGGGC
ATCCCCGACAATGACCAGCAGTTGGTCTACCACATCCACCAAAAGCCAGTCCCTCAGGACGGAAACTGCTACAGC
ACCGGTGCACACCTGGACCCTTACGGCCGGGGCGATGCCACCCCCTGCGACATCAACGCGCCACAGACCTGTCAA
GTTGGCGACCTCAGTGGCAAGCATGGACCGATCTGGGCGCCCGACAACGAGGTATTCTCCACCACGTATACGGAC
TGGTTCCTTTCCAATGTGGAGGGGGAGCCTGCCTTCTTTGGAAACCTCTCGTTGGTCGTGCATGCAGCGGATAAC
TCGCGCCTGGCGTGTGGAAACTTCGTGCAGCTGAAGTAA
Gene >Ani_SJS100_1|g1643.t1
ATGCTTTTCAAATCCACCTTCCTCGCAACTGCCACGGCTCTGTGCCTCTCCGCCACGGCTACAGCTCAGGGCGCC
AGCACCAATGCCCCCGTCGTCACAGACAATGATGATGTCCTCTACTACGCCCAGCTCCAGCCCAAGGATAACACC
ACAGTCCGCGGGTCTGTAACCATCTTCCCTAAGCCCGATAGTGTGGGTGTCCTTGTTTCGGCGCAGTTCTGGGGC
ATCCCCGACAATGACCAGCAGTTGGGTACGCCTCCCTTTCCTCCCGCTCCTTCAATATCTATCCCATCATATGGG
CTTGTGTTTAGAGTTTCCCTACGAATCCGAACCCAAACTCAAACTTTGAGTTAATAACAAACCTACACCTCAATA
CTAACCTCTTTATGAAATTGATCAGTCTACCACATCCACCAAAAGCCAGTCCCTCAGGACGGAAACTGCTACAGC
ACCGGTGCACACCTGGACCCTTACGGCCGGGGCGATGCCACCCCCTGCGACATCAACGCGCCACAGACCTGTCAA
GTTGGCGACCTCAGTGGCAAGCATGGACCGATCTGGGCGCCCGACAACGAGGTATTCTCCACCACGTATACGGAC
TGGTTCCTTTCCAATGTGGAGGGGGAGCCTGCCTTCTTTGGAAACCTCTCGTTGGTCGTGCATGCAGCGGATAAC
TCGCGCCTGGCGTGTGGAAACTTCGTGCAGCTGAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail