Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g1630.t1
Gene name
Locationscaffold_006:170325..172088
Strand+
Gene length (bp)1763
Transcript length (bp)1548
Coding sequence length (bp)1548
Protein length (aa) 516

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 2.9E-99 22 474
PF07690 MFS_1 Major Facilitator Superfamily 1.4E-28 27 424

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 63 85 22
3 90 110 20
4 117 139 22
5 154 172 18
6 185 207 22
7 308 330 22
8 337 356 19
9 376 398 22
10 437 459 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g1630.t1
MFDYDFEVNPFKSKRAYNWFISLVAAACMVLYGYDASVYNSVQGSDNWVAYFNDPDENMIGGVNTAYTVGAIVGG
FFMGGPIADFLGRKIGMATGCILVIAATFMQCFAPRGNIACFLAGRCIIGIGQGIALTAGPIYIGELAPPEIRGK
IMTFWQMFYSVGSFICFWVNYACTKHSTHLGEWDWRMVVIFQLLVPVIILFILPTIPGSPRWYIQRGNNVEKARR
ALRRVRATEDEVEDELLRIREAIEYEKEAISGSYAALWKDKSLRKRMYLALVINAGQQVSGQGTLNTYSTKIYEK
VFKSANQIALINALNATFGIIFTLNAIWIIDRFGRKFLLIVGGIGMGICMIIVAAVETETPSPGGAKTESVGISI
VFLLFLFIFFYKPSWGATIWIWTSEVFSMNVRAQAVGMATQTQNVANAIVQQFFPTFLNNCGFYAFYMFAGICFL
LALFVFFFIPETKQVPLEEIDALFGGANHVTQGEDLFSGEKQMRVTHQDTGLEKPTAVTVEDARR*
Coding >Ani_SJS100_1|g1630.t1
ATGTTTGATTACGATTTCGAAGTCAATCCTTTCAAATCGAAACGAGCCTACAACTGGTTCATCTCCCTCGTCGCA
GCAGCATGCATGGTCTTATACGGCTATGATGCGTCCGTCTATAATTCCGTTCAAGGCTCGGACAACTGGGTTGCC
TACTTCAATGACCCTGACGAGAATATGATCGGGGGTGTCAACACGGCCTACACTGTGGGTGCAATTGTCGGCGGT
TTCTTCATGGGTGGTCCCATAGCCGACTTTCTGGGTCGCAAGATTGGAATGGCGACCGGGTGCATCTTGGTCATC
GCTGCTACATTTATGCAGTGCTTTGCACCTCGTGGCAACATTGCATGCTTCCTTGCCGGACGGTGCATCATTGGT
ATTGGCCAGGGTATTGCACTGACTGCGGGTCCCATCTATATCGGTGAACTAGCACCTCCGGAGATTCGTGGAAAG
ATCATGACCTTTTGGCAAATGTTCTACTCCGTTGGTTCCTTCATCTGCTTCTGGGTGAACTACGCGTGCACCAAG
CACTCCACACACTTGGGCGAGTGGGATTGGAGAATGGTTGTCATCTTCCAACTTTTGGTGCCCGTGATCATTCTT
TTCATCTTACCTACCATTCCCGGATCGCCACGATGGTACATCCAACGTGGCAACAACGTCGAAAAGGCCCGCAGG
GCACTGCGCAGAGTCCGAGCAACCGAAGACGAGGTTGAAGACGAGCTGCTCAGAATCCGCGAAGCCATCGAGTAC
GAAAAGGAAGCCATTTCTGGCAGTTACGCTGCACTGTGGAAGGATAAGTCCCTCCGCAAGCGCATGTACCTAGCT
CTTGTGATCAACGCTGGACAGCAAGTCAGTGGACAGGGCACCCTCAACACGTACTCGACGAAGATCTACGAGAAA
GTTTTCAAAAGTGCTAACCAGATTGCTCTCATCAATGCTCTCAATGCCACCTTTGGTATCATTTTCACTCTGAAC
GCCATCTGGATCATCGATCGGTTCGGACGCAAGTTCCTTCTGATCGTTGGTGGTATCGGTATGGGCATTTGCATG
ATTATCGTTGCGGCTGTAGAGACAGAAACACCATCACCAGGTGGAGCAAAGACAGAATCGGTCGGCATATCGATC
GTGTTCTTACTTTTCTTATTCATCTTCTTCTACAAACCCTCCTGGGGCGCTACCATTTGGATTTGGACATCCGAG
GTGTTCTCAATGAACGTCCGCGCCCAAGCCGTGGGTATGGCAACCCAGACCCAGAACGTGGCCAACGCCATCGTG
CAGCAATTCTTCCCGACCTTCCTCAACAACTGCGGCTTTTACGCCTTCTACATGTTCGCAGGCATCTGCTTCCTC
CTCGCTCTATTCGTGTTTTTCTTCATCCCTGAGACCAAGCAAGTGCCGCTGGAGGAAATTGATGCCCTCTTCGGC
GGAGCCAACCACGTCACGCAGGGTGAAGACCTCTTCTCTGGCGAGAAGCAAATGCGCGTGACGCACCAGGATACG
GGGTTGGAGAAGCCTACTGCTGTCACAGTTGAGGATGCACGACGTTGA
Transcript >Ani_SJS100_1|g1630.t1
ATGTTTGATTACGATTTCGAAGTCAATCCTTTCAAATCGAAACGAGCCTACAACTGGTTCATCTCCCTCGTCGCA
GCAGCATGCATGGTCTTATACGGCTATGATGCGTCCGTCTATAATTCCGTTCAAGGCTCGGACAACTGGGTTGCC
TACTTCAATGACCCTGACGAGAATATGATCGGGGGTGTCAACACGGCCTACACTGTGGGTGCAATTGTCGGCGGT
TTCTTCATGGGTGGTCCCATAGCCGACTTTCTGGGTCGCAAGATTGGAATGGCGACCGGGTGCATCTTGGTCATC
GCTGCTACATTTATGCAGTGCTTTGCACCTCGTGGCAACATTGCATGCTTCCTTGCCGGACGGTGCATCATTGGT
ATTGGCCAGGGTATTGCACTGACTGCGGGTCCCATCTATATCGGTGAACTAGCACCTCCGGAGATTCGTGGAAAG
ATCATGACCTTTTGGCAAATGTTCTACTCCGTTGGTTCCTTCATCTGCTTCTGGGTGAACTACGCGTGCACCAAG
CACTCCACACACTTGGGCGAGTGGGATTGGAGAATGGTTGTCATCTTCCAACTTTTGGTGCCCGTGATCATTCTT
TTCATCTTACCTACCATTCCCGGATCGCCACGATGGTACATCCAACGTGGCAACAACGTCGAAAAGGCCCGCAGG
GCACTGCGCAGAGTCCGAGCAACCGAAGACGAGGTTGAAGACGAGCTGCTCAGAATCCGCGAAGCCATCGAGTAC
GAAAAGGAAGCCATTTCTGGCAGTTACGCTGCACTGTGGAAGGATAAGTCCCTCCGCAAGCGCATGTACCTAGCT
CTTGTGATCAACGCTGGACAGCAAGTCAGTGGACAGGGCACCCTCAACACGTACTCGACGAAGATCTACGAGAAA
GTTTTCAAAAGTGCTAACCAGATTGCTCTCATCAATGCTCTCAATGCCACCTTTGGTATCATTTTCACTCTGAAC
GCCATCTGGATCATCGATCGGTTCGGACGCAAGTTCCTTCTGATCGTTGGTGGTATCGGTATGGGCATTTGCATG
ATTATCGTTGCGGCTGTAGAGACAGAAACACCATCACCAGGTGGAGCAAAGACAGAATCGGTCGGCATATCGATC
GTGTTCTTACTTTTCTTATTCATCTTCTTCTACAAACCCTCCTGGGGCGCTACCATTTGGATTTGGACATCCGAG
GTGTTCTCAATGAACGTCCGCGCCCAAGCCGTGGGTATGGCAACCCAGACCCAGAACGTGGCCAACGCCATCGTG
CAGCAATTCTTCCCGACCTTCCTCAACAACTGCGGCTTTTACGCCTTCTACATGTTCGCAGGCATCTGCTTCCTC
CTCGCTCTATTCGTGTTTTTCTTCATCCCTGAGACCAAGCAAGTGCCGCTGGAGGAAATTGATGCCCTCTTCGGC
GGAGCCAACCACGTCACGCAGGGTGAAGACCTCTTCTCTGGCGAGAAGCAAATGCGCGTGACGCACCAGGATACG
GGGTTGGAGAAGCCTACTGCTGTCACAGTTGAGGATGCACGACGTTGA
Gene >Ani_SJS100_1|g1630.t1
ATGTTTGATTACGATTTCGAAGTCAATCCTTTCAAATCGAAACGAGCCTACAACTGGTACGCATGCCACGCTGGC
CTTTAGAAAGGGTCACTATACTAACAATCTGTTAGGTTCATCTCCCTCGTCGCAGCAGCATGCATGGTCTTATAC
GGCTATGATGCGTCCGTCTATAATTCCGTTCAAGGCTCGGACAACTGGGTTGCCTACTTCAATGACCCTGACGAG
AATATGATCGGGGGTGTCAACACGGCCTACACTGTGGGTGCAATTGTCGGCGGTTTCTTCATGGGTGGTCCCATA
GCCGACTTTCTGGGTCGCAAGATTGGAATGGCGACCGGGTGCATCTTGGTCATCGCTGCTACATTTATGCAGTGC
TTTGCACCTCGTGGCAACATTGCATGCTTCCTTGCCGGACGGTGCATCATTGGTATTGGCCAGGGTATTGCACTG
AGTAAGTCTGCCATCGGTCCTTTTGGCTTAAAGTTCTTACCAACGCTTTATTGATCAGCTGCGGGTCCCATCTAT
ATCGGTGAACTAGCACCTCCGGAGATTCGTGGAAAGATCATGACCTTTTGGCAAATGTTCTACTCCGTTGGTTCC
TTCATCTGCTTCTGGGTGAACTACGCGTGCACCAAGCACTCCACACACTTGGGCGAGTGGGATTGGAGAATGGTT
GTCATCTTCCAACTTTTGGTGCCCGTGATCATTCTTTTCATCTTACCTACCATTCCCGGATCGCCACGATGGTAA
GTGCTATTGTGAACGCGCGTTATGTCCTCCTCTTAACTCCTGCACAGGTACATCCAACGTGGCAACAACGTCGAA
AAGGCCCGCAGGGCACTGCGCAGAGTCCGAGCAACCGAAGACGAGGTTGAAGACGAGCTGCTCAGAATCCGCGAA
GCCATCGAGTACGAAAAGGAAGCCATTTCTGGCAGTTACGCTGCACTGTGGAAGGATAAGTCCCTCCGCAAGCGC
ATGTACCTAGCTCTTGTGATCAACGCTGGACAGCAAGTCAGTGGACAGGGCACCCTCAACACGTACTCGACGAAG
ATCTACGAGAAAGTTTTCAAAAGTGCTAACCAGATTGCTCTCATCAATGCTCTCAATGCCACCTTTGGTATCATT
TTCACTCTGAACGCCATCTGGATCATCGATCGGTTCGGACGCAAGTTCCTTCTGATCGTTGGTGGTATCGGTATG
GGCATTTGCATGATTATCGTTGCGGCTGTAGAGACAGAAACACCATCACCAGGTGGAGCAAAGACAGAATCGGTC
GGCATATCGATCGTGTTCTTACTTTTCTTATTCATCTTCTTCTGTGAGTTTCACCGACAAACGTCTTTAAATCCC
TTACTAATCAAATCTTAATAGACAAACCCTCCTGGGGCGCTACCATTTGGATTTGGACATCCGAGGTGTTCTCAA
TGAACGTCCGCGCCCAAGCCGTGGGTATGGCAACCCAGACCCAGAACGTGGCCAACGCCATCGTGCAGCAATTCT
TCCCGACCTTCCTCAACAACTGCGGCTTTTACGCCTTCTACATGTTCGCAGGCATCTGCTTCCTCCTCGCTCTAT
TCGTGTTTTTCTTCATCCCTGAGACCAAGCAAGTGCCGCTGGAGGAAATTGATGCCCTCTTCGGCGGAGCCAACC
ACGTCACGCAGGGTGAAGACCTCTTCTCTGGCGAGAAGCAAATGCGCGTGACGCACCAGGATACGGGGTTGGAGA
AGCCTACTGCTGTCACAGTTGAGGATGCACGACGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail