Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g1519.t1
Gene name
Locationscaffold_005:541454..546066
Strand+
Gene length (bp)4612
Transcript length (bp)4395
Coding sequence length (bp)4395
Protein length (aa) 1465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00136 DNA_pol_B DNA polymerase family B 3.9E-118 785 1230
PF08996 zf-DNA_Pol DNA Polymerase alpha zinc finger 2.8E-70 1269 1459
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 6.9E-42 376 718
PF12254 DNA_pol_alpha_N DNA polymerase alpha subunit p180 N terminal 1.2E-23 8 72

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0000166 nucleotide binding Yes
GO:0006260 DNA replication Yes
GO:0003887 DNA-directed DNA polymerase activity Yes
GO:0016740 transferase activity No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0036094 small molecule binding No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0034061 DNA polymerase activity No
GO:0003824 catalytic activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0003676 nucleic acid binding No
GO:0140097 catalytic activity, acting on DNA No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g1519.t1
MSASRAKLAELRALRAAGKKRLSTYEVEEQGDIYEEVDDEGYKKIIRNRLDQDDFVVDDNGEGYADDGREVWNER
TADYGDSESEDDELPARGKAAKRKREEEKQRQEKINNGISKYFNSGAAPSAPKPKPVATAEDDAFMADLLGEVDT
NVVPHRVPTRNIVKTEARRKVRILSPPLADRTRKERPIKKDENSDPVSPVKDQPELNFDDDDGALPGMDDDDVPM
SDPMPSSPISKAVERKSTTTPVKVEEFDDDDNDIMEIAQVTGQNDAKATSINMAGSRPPPKLKKESTPALASSSP
TKPMPEVDASWNDVRSKLNVLSSPASSEMRSFGKLRAQDVVEEDGSLRMFWLDFTEVNGSLCLFGKVKNKQNGSY
ASAFVKVDNILRKLYFLPREYRHKNGRETDEEVDMEDVYHEVDGMMSRLRVGMHKMKPCTRKYAFELPGVPKETE
YLKLFYPYDKSPLPMDVKGETFSHVFGTNTSLFEQFVLWKNIMGPCWLKIEEADFTAVNNASWCKFECQAAKPAL
ISPVPDSENLEAPPLTLMSLSFRTQLNVTENKQEILVASARVYENVSLTDTTPPERLPCKTFTVMRPAGSSYPMH
FEAETRKQRGTFMLEKSEQFLLSKFLALFEKMDPDVLMGHQLQEVDLSILLSRLKEKKTPGWHRLGRLKRGDWPK
NFNRGGGFFAERHLIAGRLMCDVANDMGKSLMMKCQSWSLTEMCDLYLGKENARQELDCEAALKTWATTKDGLMN
FVNHCDADTYFIAALVLRLQMLPLTKVLTNIAGNSWARTLSGTRAERNEYILLHEFHRNKYICPDKYSSKLLKAE
EKMQEGDDDESADKKKKDKYKGGLVFEPEKGLYDKFILVMDFNSLYPSIIQEYNICFTTVERTATADNDKEEKVP
EVPTSDQEQGILPKLIATLVGRRREVKKLMKDKRATPEQLALWDTKQLAFKLTANSMYGCLGYTQSRFYARPLAM
LTTFKGREILRSTKELAESKQLRVIYGDTDSVMINTNMDTISDALKVGDEFKKSVNERYRLLEIDIDNVFRCLLL
HAKKKYAAINMTEVDGKYVDKLEVKGLDMKRREYCSLSKEVSQKLLNEVLSGEDQEVVLNRVHDYLRELAEKMRE
FSVPVQKYVIYTKLSKRPEEYPNKESMPPVQVALRELARGKSVRPNDVISYVVTNGDAETSSLAPAKRSYTLQDV
MKPDSGLKPDIEFYLLKQIFPPIERLCAPIPGTDAVRLAECLGLDVRKYQINSSSGSNQQNADIFPLESQIPDSV
RFENATRLTLTCRFCKEKSVFEGLAQSTHMCTANGIICPNQACQKPFSVLTIVAQLEAQIRAQTSKYYEGWLVCD
DTACGNRTRQISVYGHRCLGPRGHAEGCLGRMTYEYSEKQMYNQLLYFAGLWDVDKARKAAEKEPTGEKKDGVAA
LAEFNRIRFGTIKGVVDAYLKKCGRQWVEMDSLFRFMLP*
Coding >Ani_SJS100_1|g1519.t1
ATGTCTGCTTCCCGCGCCAAATTGGCGGAGCTGCGCGCCCTTCGCGCCGCAGGAAAGAAACGCCTGTCGACATAC
GAAGTTGAGGAACAAGGCGACATTTACGAGGAGGTTGACGATGAGGGCTACAAGAAGATTATCCGCAACCGGCTT
GATCAGGATGACTTCGTGGTCGACGATAACGGAGAAGGTTATGCAGACGACGGTCGCGAGGTGTGGAACGAGCGG
ACTGCAGACTACGGCGACAGCGAGAGTGAAGACGACGAATTGCCTGCCCGGGGTAAGGCTGCGAAGAGGAAGCGC
GAGGAGGAAAAGCAACGACAGGAGAAGATCAATAATGGCATCTCGAAATATTTCAACAGCGGGGCTGCGCCCTCT
GCTCCCAAGCCCAAGCCGGTCGCTACTGCAGAAGACGACGCTTTCATGGCCGATTTGCTCGGAGAAGTCGATACC
AACGTGGTCCCGCATCGAGTCCCTACGAGGAATATAGTCAAGACTGAGGCTCGTCGCAAAGTTCGCATCTTGTCA
CCCCCGCTCGCCGATAGAACACGCAAAGAAAGGCCTATAAAGAAAGATGAAAACAGTGACCCGGTTTCGCCGGTT
AAGGATCAACCAGAGCTCAATTTCGACGACGACGATGGGGCACTTCCTGGTATGGATGATGACGACGTTCCCATG
AGTGACCCAATGCCATCGTCTCCCATCAGCAAAGCGGTAGAACGAAAGTCAACCACAACTCCTGTCAAGGTCGAG
GAGTTCGATGATGATGATAATGATATAATGGAAATCGCGCAAGTCACTGGTCAGAACGACGCTAAGGCGACCAGC
ATCAACATGGCTGGAAGCCGGCCCCCGCCCAAACTCAAGAAGGAGAGCACTCCGGCTCTGGCTAGCTCCTCGCCT
ACAAAGCCAATGCCAGAAGTAGACGCATCTTGGAATGACGTAAGGAGCAAGCTGAATGTTCTCAGCAGCCCTGCG
TCGTCGGAAATGCGTAGCTTCGGTAAGCTTCGCGCCCAAGATGTCGTCGAGGAAGACGGAAGTCTGCGCATGTTC
TGGTTGGATTTCACAGAAGTCAATGGCAGTCTTTGCCTGTTTGGAAAGGTGAAGAACAAGCAAAATGGTTCTTAC
GCCAGTGCATTCGTCAAGGTTGACAACATCCTACGCAAGCTCTATTTCCTGCCACGAGAGTATCGGCACAAGAAT
GGGCGAGAGACGGATGAAGAGGTGGACATGGAAGATGTTTATCATGAAGTCGATGGGATGATGTCCAGGTTGAGG
GTAGGTATGCACAAGATGAAGCCCTGCACGCGCAAATACGCTTTCGAATTGCCTGGTGTCCCGAAAGAGACCGAA
TACCTGAAGCTCTTTTATCCTTATGACAAATCTCCGTTGCCAATGGATGTGAAGGGTGAGACCTTTTCGCATGTA
TTCGGCACAAACACGTCATTGTTCGAGCAGTTTGTTCTCTGGAAGAATATCATGGGTCCTTGTTGGCTGAAAATC
GAAGAGGCGGATTTCACTGCTGTCAACAACGCGTCTTGGTGCAAATTTGAATGCCAAGCGGCAAAGCCGGCACTT
ATTTCTCCTGTACCTGATTCTGAGAATCTAGAAGCGCCTCCTCTGACGCTTATGAGTCTCTCCTTCCGAACCCAG
CTCAACGTGACAGAGAACAAGCAGGAGATCCTTGTGGCGAGTGCAAGAGTATATGAGAATGTCTCCCTTACGGAC
ACCACTCCGCCCGAGAGGCTGCCCTGCAAGACGTTCACAGTCATGCGGCCTGCCGGCTCTTCATACCCAATGCAC
TTCGAAGCCGAAACGCGAAAGCAGCGGGGCACCTTCATGCTAGAGAAGAGCGAACAGTTTTTGCTCAGCAAGTTC
CTGGCGCTGTTCGAGAAGATGGATCCCGATGTTCTAATGGGACATCAGCTTCAGGAGGTTGACCTCAGCATTCTG
CTCAGCAGATTGAAGGAGAAGAAGACCCCTGGCTGGCATCGCCTTGGAAGGTTGAAGCGCGGCGACTGGCCCAAG
AACTTCAACAGAGGTGGAGGTTTCTTCGCCGAGAGGCACCTGATTGCTGGAAGGCTGATGTGTGATGTAGCCAAT
GATATGGGCAAGTCTCTGATGATGAAATGTCAATCTTGGAGTTTGACGGAGATGTGTGACCTCTACCTCGGAAAG
GAAAATGCCAGACAAGAACTGGATTGCGAGGCAGCACTGAAGACATGGGCTACTACCAAGGATGGCCTCATGAAC
TTCGTCAATCACTGTGATGCGGATACCTATTTCATTGCTGCGTTGGTCCTGCGGCTTCAGATGTTGCCCTTGACC
AAGGTTCTCACGAATATTGCTGGTAACTCTTGGGCAAGAACGCTCAGTGGTACGCGTGCTGAGCGGAATGAGTAT
ATTCTTCTCCATGAATTCCACCGTAACAAGTACATCTGTCCCGACAAATACTCCTCCAAGCTACTGAAAGCTGAA
GAGAAGATGCAAGAAGGTGATGATGATGAGTCGGCGGATAAGAAAAAGAAGGACAAGTACAAGGGTGGTCTTGTT
TTTGAACCTGAGAAGGGTCTTTATGACAAGTTCATCCTTGTGATGGACTTCAACAGTCTGTATCCCAGTATCATC
CAGGAGTACAATATCTGCTTTACAACAGTGGAACGAACAGCGACTGCGGATAATGACAAGGAAGAAAAGGTTCCC
GAAGTTCCTACCTCGGATCAGGAGCAGGGTATCCTGCCCAAGCTTATTGCTACTTTGGTCGGTCGTCGACGTGAA
GTCAAGAAGCTGATGAAGGACAAGCGCGCCACTCCTGAGCAGCTTGCTCTGTGGGACACCAAACAGCTGGCCTTC
AAGCTGACCGCTAACTCCATGTACGGATGCTTGGGATACACACAGAGTCGCTTCTACGCACGTCCTTTAGCCATG
CTCACCACGTTCAAGGGTCGTGAGATTCTCAGAAGCACCAAGGAACTGGCAGAGTCCAAGCAGCTTAGAGTCATC
TATGGTGATACTGACTCGGTCATGATCAACACGAACATGGACACGATCAGCGATGCGCTAAAGGTCGGCGATGAG
TTCAAGAAATCAGTAAACGAGCGTTACCGATTACTGGAGATCGACATTGATAATGTGTTCCGTTGTCTGCTTCTT
CACGCAAAGAAGAAGTATGCCGCCATCAACATGACTGAAGTAGATGGCAAGTACGTGGACAAACTCGAAGTCAAA
GGTCTGGATATGAAGAGACGTGAATATTGCTCGTTGTCGAAGGAGGTCTCCCAGAAACTGCTGAATGAGGTTCTC
TCCGGTGAGGATCAGGAGGTTGTCCTCAATCGCGTCCATGACTATCTACGCGAGTTGGCCGAGAAGATGCGCGAG
TTCTCCGTCCCCGTCCAAAAATACGTCATTTACACGAAACTTTCCAAGCGACCCGAGGAATATCCTAACAAGGAA
TCCATGCCCCCGGTACAAGTTGCCTTGCGCGAACTTGCCCGTGGTAAATCGGTTCGCCCTAACGACGTGATATCG
TATGTCGTAACGAATGGTGATGCCGAGACCTCGTCTCTTGCACCGGCCAAACGGTCATACACTCTTCAGGACGTG
ATGAAGCCGGACTCAGGACTCAAGCCTGATATCGAATTCTACCTTCTCAAGCAGATCTTCCCACCGATTGAACGT
CTCTGTGCCCCCATCCCCGGTACCGATGCCGTTCGACTAGCCGAGTGCTTGGGGCTTGATGTCCGCAAGTACCAG
ATTAATAGCTCCAGTGGGAGCAACCAACAGAATGCCGATATCTTTCCGCTCGAGTCGCAGATTCCAGACTCTGTG
CGTTTTGAGAACGCTACCCGGCTTACGCTTACCTGCCGGTTCTGCAAGGAGAAGTCGGTCTTTGAAGGACTCGCA
CAGTCCACCCACATGTGCACTGCCAACGGCATCATTTGTCCCAACCAGGCGTGTCAGAAGCCATTCTCTGTCTTG
ACGATCGTTGCCCAGTTGGAGGCACAAATTCGAGCACAGACGTCCAAGTACTATGAGGGCTGGCTCGTCTGTGAC
GACACGGCGTGCGGCAACCGGACTAGACAGATCAGCGTGTATGGACACCGGTGCCTTGGACCCCGGGGCCACGCT
GAGGGCTGCCTTGGTCGAATGACGTACGAGTACTCGGAGAAGCAGATGTATAACCAACTACTTTACTTCGCAGGA
CTTTGGGACGTGGACAAGGCTCGGAAAGCGGCCGAGAAGGAGCCCACTGGGGAAAAGAAGGACGGCGTGGCGGCC
CTGGCTGAGTTCAACCGCATACGTTTTGGAACCATCAAAGGGGTGGTGGACGCATATCTGAAGAAGTGCGGCCGG
CAATGGGTCGAAATGGACAGTCTGTTCCGCTTCATGCTGCCGTGA
Transcript >Ani_SJS100_1|g1519.t1
ATGTCTGCTTCCCGCGCCAAATTGGCGGAGCTGCGCGCCCTTCGCGCCGCAGGAAAGAAACGCCTGTCGACATAC
GAAGTTGAGGAACAAGGCGACATTTACGAGGAGGTTGACGATGAGGGCTACAAGAAGATTATCCGCAACCGGCTT
GATCAGGATGACTTCGTGGTCGACGATAACGGAGAAGGTTATGCAGACGACGGTCGCGAGGTGTGGAACGAGCGG
ACTGCAGACTACGGCGACAGCGAGAGTGAAGACGACGAATTGCCTGCCCGGGGTAAGGCTGCGAAGAGGAAGCGC
GAGGAGGAAAAGCAACGACAGGAGAAGATCAATAATGGCATCTCGAAATATTTCAACAGCGGGGCTGCGCCCTCT
GCTCCCAAGCCCAAGCCGGTCGCTACTGCAGAAGACGACGCTTTCATGGCCGATTTGCTCGGAGAAGTCGATACC
AACGTGGTCCCGCATCGAGTCCCTACGAGGAATATAGTCAAGACTGAGGCTCGTCGCAAAGTTCGCATCTTGTCA
CCCCCGCTCGCCGATAGAACACGCAAAGAAAGGCCTATAAAGAAAGATGAAAACAGTGACCCGGTTTCGCCGGTT
AAGGATCAACCAGAGCTCAATTTCGACGACGACGATGGGGCACTTCCTGGTATGGATGATGACGACGTTCCCATG
AGTGACCCAATGCCATCGTCTCCCATCAGCAAAGCGGTAGAACGAAAGTCAACCACAACTCCTGTCAAGGTCGAG
GAGTTCGATGATGATGATAATGATATAATGGAAATCGCGCAAGTCACTGGTCAGAACGACGCTAAGGCGACCAGC
ATCAACATGGCTGGAAGCCGGCCCCCGCCCAAACTCAAGAAGGAGAGCACTCCGGCTCTGGCTAGCTCCTCGCCT
ACAAAGCCAATGCCAGAAGTAGACGCATCTTGGAATGACGTAAGGAGCAAGCTGAATGTTCTCAGCAGCCCTGCG
TCGTCGGAAATGCGTAGCTTCGGTAAGCTTCGCGCCCAAGATGTCGTCGAGGAAGACGGAAGTCTGCGCATGTTC
TGGTTGGATTTCACAGAAGTCAATGGCAGTCTTTGCCTGTTTGGAAAGGTGAAGAACAAGCAAAATGGTTCTTAC
GCCAGTGCATTCGTCAAGGTTGACAACATCCTACGCAAGCTCTATTTCCTGCCACGAGAGTATCGGCACAAGAAT
GGGCGAGAGACGGATGAAGAGGTGGACATGGAAGATGTTTATCATGAAGTCGATGGGATGATGTCCAGGTTGAGG
GTAGGTATGCACAAGATGAAGCCCTGCACGCGCAAATACGCTTTCGAATTGCCTGGTGTCCCGAAAGAGACCGAA
TACCTGAAGCTCTTTTATCCTTATGACAAATCTCCGTTGCCAATGGATGTGAAGGGTGAGACCTTTTCGCATGTA
TTCGGCACAAACACGTCATTGTTCGAGCAGTTTGTTCTCTGGAAGAATATCATGGGTCCTTGTTGGCTGAAAATC
GAAGAGGCGGATTTCACTGCTGTCAACAACGCGTCTTGGTGCAAATTTGAATGCCAAGCGGCAAAGCCGGCACTT
ATTTCTCCTGTACCTGATTCTGAGAATCTAGAAGCGCCTCCTCTGACGCTTATGAGTCTCTCCTTCCGAACCCAG
CTCAACGTGACAGAGAACAAGCAGGAGATCCTTGTGGCGAGTGCAAGAGTATATGAGAATGTCTCCCTTACGGAC
ACCACTCCGCCCGAGAGGCTGCCCTGCAAGACGTTCACAGTCATGCGGCCTGCCGGCTCTTCATACCCAATGCAC
TTCGAAGCCGAAACGCGAAAGCAGCGGGGCACCTTCATGCTAGAGAAGAGCGAACAGTTTTTGCTCAGCAAGTTC
CTGGCGCTGTTCGAGAAGATGGATCCCGATGTTCTAATGGGACATCAGCTTCAGGAGGTTGACCTCAGCATTCTG
CTCAGCAGATTGAAGGAGAAGAAGACCCCTGGCTGGCATCGCCTTGGAAGGTTGAAGCGCGGCGACTGGCCCAAG
AACTTCAACAGAGGTGGAGGTTTCTTCGCCGAGAGGCACCTGATTGCTGGAAGGCTGATGTGTGATGTAGCCAAT
GATATGGGCAAGTCTCTGATGATGAAATGTCAATCTTGGAGTTTGACGGAGATGTGTGACCTCTACCTCGGAAAG
GAAAATGCCAGACAAGAACTGGATTGCGAGGCAGCACTGAAGACATGGGCTACTACCAAGGATGGCCTCATGAAC
TTCGTCAATCACTGTGATGCGGATACCTATTTCATTGCTGCGTTGGTCCTGCGGCTTCAGATGTTGCCCTTGACC
AAGGTTCTCACGAATATTGCTGGTAACTCTTGGGCAAGAACGCTCAGTGGTACGCGTGCTGAGCGGAATGAGTAT
ATTCTTCTCCATGAATTCCACCGTAACAAGTACATCTGTCCCGACAAATACTCCTCCAAGCTACTGAAAGCTGAA
GAGAAGATGCAAGAAGGTGATGATGATGAGTCGGCGGATAAGAAAAAGAAGGACAAGTACAAGGGTGGTCTTGTT
TTTGAACCTGAGAAGGGTCTTTATGACAAGTTCATCCTTGTGATGGACTTCAACAGTCTGTATCCCAGTATCATC
CAGGAGTACAATATCTGCTTTACAACAGTGGAACGAACAGCGACTGCGGATAATGACAAGGAAGAAAAGGTTCCC
GAAGTTCCTACCTCGGATCAGGAGCAGGGTATCCTGCCCAAGCTTATTGCTACTTTGGTCGGTCGTCGACGTGAA
GTCAAGAAGCTGATGAAGGACAAGCGCGCCACTCCTGAGCAGCTTGCTCTGTGGGACACCAAACAGCTGGCCTTC
AAGCTGACCGCTAACTCCATGTACGGATGCTTGGGATACACACAGAGTCGCTTCTACGCACGTCCTTTAGCCATG
CTCACCACGTTCAAGGGTCGTGAGATTCTCAGAAGCACCAAGGAACTGGCAGAGTCCAAGCAGCTTAGAGTCATC
TATGGTGATACTGACTCGGTCATGATCAACACGAACATGGACACGATCAGCGATGCGCTAAAGGTCGGCGATGAG
TTCAAGAAATCAGTAAACGAGCGTTACCGATTACTGGAGATCGACATTGATAATGTGTTCCGTTGTCTGCTTCTT
CACGCAAAGAAGAAGTATGCCGCCATCAACATGACTGAAGTAGATGGCAAGTACGTGGACAAACTCGAAGTCAAA
GGTCTGGATATGAAGAGACGTGAATATTGCTCGTTGTCGAAGGAGGTCTCCCAGAAACTGCTGAATGAGGTTCTC
TCCGGTGAGGATCAGGAGGTTGTCCTCAATCGCGTCCATGACTATCTACGCGAGTTGGCCGAGAAGATGCGCGAG
TTCTCCGTCCCCGTCCAAAAATACGTCATTTACACGAAACTTTCCAAGCGACCCGAGGAATATCCTAACAAGGAA
TCCATGCCCCCGGTACAAGTTGCCTTGCGCGAACTTGCCCGTGGTAAATCGGTTCGCCCTAACGACGTGATATCG
TATGTCGTAACGAATGGTGATGCCGAGACCTCGTCTCTTGCACCGGCCAAACGGTCATACACTCTTCAGGACGTG
ATGAAGCCGGACTCAGGACTCAAGCCTGATATCGAATTCTACCTTCTCAAGCAGATCTTCCCACCGATTGAACGT
CTCTGTGCCCCCATCCCCGGTACCGATGCCGTTCGACTAGCCGAGTGCTTGGGGCTTGATGTCCGCAAGTACCAG
ATTAATAGCTCCAGTGGGAGCAACCAACAGAATGCCGATATCTTTCCGCTCGAGTCGCAGATTCCAGACTCTGTG
CGTTTTGAGAACGCTACCCGGCTTACGCTTACCTGCCGGTTCTGCAAGGAGAAGTCGGTCTTTGAAGGACTCGCA
CAGTCCACCCACATGTGCACTGCCAACGGCATCATTTGTCCCAACCAGGCGTGTCAGAAGCCATTCTCTGTCTTG
ACGATCGTTGCCCAGTTGGAGGCACAAATTCGAGCACAGACGTCCAAGTACTATGAGGGCTGGCTCGTCTGTGAC
GACACGGCGTGCGGCAACCGGACTAGACAGATCAGCGTGTATGGACACCGGTGCCTTGGACCCCGGGGCCACGCT
GAGGGCTGCCTTGGTCGAATGACGTACGAGTACTCGGAGAAGCAGATGTATAACCAACTACTTTACTTCGCAGGA
CTTTGGGACGTGGACAAGGCTCGGAAAGCGGCCGAGAAGGAGCCCACTGGGGAAAAGAAGGACGGCGTGGCGGCC
CTGGCTGAGTTCAACCGCATACGTTTTGGAACCATCAAAGGGGTGGTGGACGCATATCTGAAGAAGTGCGGCCGG
CAATGGGTCGAAATGGACAGTCTGTTCCGCTTCATGCTGCCGTGA
Gene >Ani_SJS100_1|g1519.t1
ATGTCTGCTTCCCGCGCCAAATTGGCGGAGCTGCGCGCCCTTCGCGCCGCAGGAAAGAAACGCCTGTCGACATAC
GAAGTTGAGGAACAAGGCGACATTTACGAGGAGGTTGACGATGAGGGCTACAAGAAGATTATCCGCAACCGGCTT
GATCAGGATGACTTCGTGGTCGACGATAACGGAGAAGGTTATGCAGACGACGGTCGCGAGGTGTGGAACGAGCGG
ACTGCAGACTACGGCGACAGCGAGAGTGAAGACGACGAATTGCCTGCCCGGGGTAAGGCTGCGAAGAGGAAGCGC
GAGGAGGAAAAGCAACGACAGGAGAAGATCAATAATGGCATCTCGAAATATTTCAACAGCGGGGCTGCGCCCTCT
GCTCCCAAGCCCAAGGTGAGTTGAAGAAGAGTTCTGTTGAGCACAAATGGCTCTCTCTAATGTTCTGTTTAGCCG
GTCGCTACTGCAGAAGACGACGCTTTCATGGCCGATTTGCTCGGAGAAGTCGATACCAACGTGGTCCCGCATCGA
GTCCCTACGAGGAATATAGTCAAGACTGAGGCTCGTCGCAAAGTTCGCATCTTGTCACCCCCGCTCGCCGATAGA
ACACGCAAAGAAAGGCCTATAAAGAAAGATGAAAACAGTGACCCGGTTTCGCCGGTTAAGGATCAACCAGAGCTC
AATTTCGACGACGACGATGGGGCACTTCCTGGTATGGATGATGACGACGTTCCCATGAGTGACCCAATGCCATCG
TCTCCCATCAGCAAAGCGGTAGAACGAAAGTCAACCACAACTCCTGTCAAGGTCGAGGAGTTCGATGATGATGAT
AATGATATAATGGAAATCGCGCAAGTCACTGGTCAGAACGACGCTAAGGCGACCAGCATCAACATGGCTGGAAGC
CGGCCCCCGCCCAAACTCAAGAAGGAGAGCACTCCGGCTCTGGCTAGCTCCTCGCCTACAAAGCCAATGCCAGAA
GTAGACGCATCTTGGAATGACGTAAGGAGCAAGCTGAATGTTCTCAGCAGCCCTGCGTCGTCGGAAATGCGTAGC
TTCGGTAAGCTTCGCGCCCAAGATGTCGTCGAGGAAGACGGAAGTCTGCGCATGTTCTGGTTGGATTTCACAGAA
GTCAATGGCAGTCTTTGCCTGTTTGGAAAGGTGAAGAACAAGCAAAATGGTTCTTACGCCAGTGCATTCGTCAAG
GTTGACAACATCCTACGCAAGCTCTATTTCCTGCCACGAGAGTATCGGCACAAGAATGGGCGAGAGACGGATGAA
GAGGTGGACATGGAAGATGTTTATCATGAAGTCGATGGGATGATGTCCAGGTTGAGGGTAGGTATGCACAAGATG
AAGCCCTGCACGCGCAAATACGCTTTCGAATTGCCTGGTGTCCCGAAAGAGACCGAATACCTGAAGCTCTTTTAT
CCTTATGACAAATCTCCGTTGCCAATGGATGTGAAGGGTGAGACCTTTTCGCATGTATTCGGCACAAACACGTCA
TTGTTCGAGCAGTTTGTTCTCTGGAAGAATATCATGGGTCCTTGTTGGCTGAAAATCGAAGAGGCGGATTTCACT
GCTGTCAACAACGCGTCTTGGTGCAAATTTGAATGCCAAGCGGCAAAGCCGGCACTTATTTCTCCTGTACCTGAT
TCTGAGAATCTAGAAGCGCCTCCTCTGACGCTTATGAGTCTCTCCTTCCGAACCCAGCTCAACGTGACAGAGAAC
AAGCAGGAGATCCTTGTGGCGAGTGCAAGAGTATATGAGAATGTCTCCCTTACGGACACCACTCCGCCCGAGAGG
CTGCCCTGCAAGACGTTCACAGTCATGCGGCCTGCCGGCTCTTCATACCCAATGCACTTCGAAGCCGAAACGCGA
AAGCAGCGGGGCACCTTCATGCTAGAGAAGAGCGAACAGTTTTTGCTCAGCAAGTTCCTGGCGCTGTTCGAGAAG
ATGGATCCCGATGTTCTAATGGGACATCAGCTTCAGGAGGTTGACCTCAGCATTCTGCTCAGCAGATTGAAGGAG
AAGAAGACCCCTGGCTGGCATCGCCTTGGAAGGTTGAAGCGCGGCGACTGGCCCAAGAACTTCAACAGAGGTGGA
GGTTTCTTCGCCGAGAGGCACCTGATTGCTGGAAGGCTGATGTGTGATGTAGCCAATGATATGGGCAAGGTAGGT
TTTCCGTTTACTCTTTCAATTCAAGGTGACTTTGTACTAATGGTTGGAAGTCTCTGATGATGAAATGTCAATCTT
GGAGTTTGACGGAGATGTGTGACCTCTACCTCGGAAAGGAAAATGCCAGACAAGAACTGGATTGCGAGGCAGCAC
TGAAGACATGGGCTACTACCAAGGATGGCCTCATGAACTTCGTCAATCACTGTGATGCGGATACCTATTTCATTG
CTGCGTTGGTCCTGCGGCTTCAGATGTTGCCCTTGACCAAGGTTCTCACGAATATTGCTGGTAACTCTTGGGCAA
GAACGCTCAGTGGTACGCGTGCTGAGCGGAATGAGTATATTCTTCTCCATGAATTCCACCGTAACAAGTACATCT
GTCCCGACAAATACTCCTCCAAGCTACTGAAAGCTGAAGAGAAGATGCAAGAAGGTGATGATGATGAGTCGGCGG
ATAAGAAAAAGAAGGACAAGTACAAGGGTGGTCTTGTTTTTGAACCTGAGAAGGGTCTTTATGACAAGTTCATCC
TTGTGATGGACTTCAACAGTCTGTATCCCAGTATCATCCAGGAGTACAATATCTGCTTTACAACAGTGGAACGAA
CAGCGACTGTGAGTTCATATGCCAAGGAAAGTGTATGGAACATGGGCTGACATCTCCAGGCGGATAATGACAAGG
AAGAAAAGGTTCCCGAAGTTCCTACCTCGGATCAGGAGCAGGGTATCCTGCCCAAGCTTATTGCTACTTTGGTCG
GTCGTCGACGTGAAGTCAAGAAGCTGATGAAGGACAAGCGCGCCACTCCTGAGCAGCTTGCTCTGTGGGACACCA
AACAGCTGGCCTTCAAGCTGACCGCTAACTCCATGTACGGATGCTTGGGATACACACAGAGTCGCTTCTACGCAC
GTCCTTTAGCCATGCTCACCACGTTCAAGGGTCGTGAGATTCTCAGAAGCACCAAGGAACTGGCAGAGTCCAAGC
AGCTTAGAGTCATCTATGGTGATACTGACTCGGTCATGATCAACACGAACATGGACACGATCAGCGATGCGCTAA
AGGTCGGCGATGAGTTCAAGAAATCAGTAAACGAGCGTTACCGATTACTGGAGATCGACATTGATAATGTGTTCC
GTTGTCTGCTTCTTCACGCAAAGAAGAAGTATGCCGCCATCAACATGACTGAAGTAGATGGCAAGTACGTGGACA
AACTCGAAGTCAAAGGTCTGGATATGAAGAGACGTGAATATTGCTCGTTGTCGAAGGAGGTCTCCCAGAAACTGC
TGAATGAGGTTCTCTCCGGTGAGGATCAGGAGGTTGTCCTCAATCGCGTCCATGACTATCTACGCGAGTTGGCCG
AGAAGATGCGCGAGTTCTCCGTCCCCGTCCAAAAATACGTCATTTACACGGTATGTTTTGATTAAAGCTCACTCG
TCTGGCTCGCGCTAACTCACCTGCCTAGAAACTTTCCAAGCGACCCGAGGAATATCCTAACAAGGAATCCATGCC
CCCGGTACAAGTTGCCTTGCGCGAACTTGCCCGTGGTAAATCGGTTCGCCCTAACGACGTGATATCGTATGTCGT
AACGAATGGTGATGCCGAGACCTCGTCTCTTGCACCGGCCAAACGGTCATACACTCTTCAGGACGTGATGAAGCC
GGACTCAGGACTCAAGCCTGATATCGAATTCTACCTTCTCAAGCAGATCTTCCCACCGATTGAACGTCTCTGTGC
CCCCATCCCCGGTACCGATGCCGTTCGACTAGCCGAGTGCTTGGGGCTTGATGTCCGCAAGTACCAGATTAATAG
CTCCAGTGGGAGCAACCAACAGAATGCCGATATCTTTCCGCTCGAGTCGCAGATTCCAGACTCTGTGCGTTTTGA
GAACGCTACCCGGCTTACGCTTACCTGCCGGTTCTGCAAGGAGAAGTCGGTCTTTGAAGGACTCGCACAGTCCAC
CCACATGTGCACTGCCAACGGCATCATTTGTCCCAACCAGGCGTGTCAGAAGCCATTCTCTGTCTTGACGATCGT
TGCCCAGTTGGAGGCACAAATTCGAGCACAGACGTCCAAGTACTATGAGGGCTGGCTCGTCTGTGACGACACGGC
GTGCGGCAACCGGACTAGACAGATCAGCGTGTATGGACACCGGTGCCTTGGACCCCGGGGCCACGCTGAGGGCTG
CCTTGGTCGAATGACGTACGAGTACTCGGAGAAGCAGATGTATAACCAACTACTTTACTTCGCAGGACTTTGGGA
CGTGGACAAGGCTCGGAAAGCGGCCGAGAAGGAGCCCACTGGGGAAAAGAAGGACGGCGTGGCGGCCCTGGCTGA
GTTCAACCGCATACGTTTTGGAACCATCAAAGGGGTGGTGGACGCATATCTGAAGAAGTGCGGCCGGCAATGGGT
CGAAATGGACAGTCTGTTCCGCTTCATGCTGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail