Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g1417.t1
Gene name
Locationscaffold_005:209701..210665
Strand+
Gene length (bp)964
Transcript length (bp)888
Coding sequence length (bp)888
Protein length (aa) 296

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone 1.8E-15 181 244

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Histone-like TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g1417.t1
MTDQDQSYRPRSPDFSTFQSVPLSPTFNNHNLNHNAHYQHPHHSPVYQFGNPFAHRASYDASPFFTPQYQPPPLP
QQPPSLPHHPVPQTRVPQQSSSYFPPDPDMARRSSRIAQAAEVAPHPPVSKYVDPVDPVDEEDYVPSPPPQPQPQ
PQPQEEPVAIIEEEEPPKPAPAPVNVEVKTKFPVARIKRIMQADEDVGKVAQVTPIAVSKALELFMISLVTKAAR
EAKDRNSKRVTASHLKQAVVKDEVLDFLADIIAKVPDQPASRKHDDDNSDQNEQQPKRKRGGRRPKEESD*
Coding >Ani_SJS100_1|g1417.t1
ATGACAGACCAAGACCAATCCTATCGTCCACGATCCCCTGATTTTTCCACCTTCCAGTCAGTTCCCCTCTCACCT
ACCTTCAACAACCACAACCTCAACCACAACGCGCACTATCAACATCCTCACCACTCCCCGGTTTACCAATTCGGG
AATCCTTTCGCCCATCGCGCTTCCTACGACGCCTCGCCGTTCTTCACCCCGCAGTATCAACCACCACCTCTACCA
CAACAACCACCATCGCTTCCTCACCACCCGGTCCCGCAGACCAGGGTTCCCCAGCAATCCTCCTCATATTTCCCT
CCCGATCCGGACATGGCTCGTCGTTCGTCGCGTATCGCCCAAGCGGCCGAGGTCGCGCCTCATCCGCCCGTCTCC
AAGTACGTCGACCCCGTCGACCCCGTCGACGAAGAGGACTATGTACCTTCACCACCACCTCAACCACAACCACAA
CCACAACCACAAGAGGAACCCGTCGCAATTATTGAGGAAGAAGAGCCTCCGAAGCCCGCTCCTGCACCCGTCAAT
GTGGAAGTGAAGACCAAGTTTCCCGTCGCGCGTATAAAGCGCATCATGCAAGCCGATGAAGATGTCGGTAAAGTC
GCTCAAGTTACTCCTATCGCAGTGTCCAAAGCTCTCGAACTCTTCATGATTTCCCTCGTCACCAAAGCCGCCCGC
GAAGCCAAAGACCGCAACTCGAAACGCGTCACAGCCTCGCATCTCAAACAAGCCGTCGTTAAAGACGAAGTGCTC
GACTTCCTCGCTGACATCATCGCCAAGGTTCCTGATCAACCGGCTAGTCGGAAACACGACGACGATAACAGTGAT
CAGAATGAACAACAACCGAAACGAAAGCGCGGTGGACGTCGTCCGAAAGAAGAGAGTGATTAA
Transcript >Ani_SJS100_1|g1417.t1
ATGACAGACCAAGACCAATCCTATCGTCCACGATCCCCTGATTTTTCCACCTTCCAGTCAGTTCCCCTCTCACCT
ACCTTCAACAACCACAACCTCAACCACAACGCGCACTATCAACATCCTCACCACTCCCCGGTTTACCAATTCGGG
AATCCTTTCGCCCATCGCGCTTCCTACGACGCCTCGCCGTTCTTCACCCCGCAGTATCAACCACCACCTCTACCA
CAACAACCACCATCGCTTCCTCACCACCCGGTCCCGCAGACCAGGGTTCCCCAGCAATCCTCCTCATATTTCCCT
CCCGATCCGGACATGGCTCGTCGTTCGTCGCGTATCGCCCAAGCGGCCGAGGTCGCGCCTCATCCGCCCGTCTCC
AAGTACGTCGACCCCGTCGACCCCGTCGACGAAGAGGACTATGTACCTTCACCACCACCTCAACCACAACCACAA
CCACAACCACAAGAGGAACCCGTCGCAATTATTGAGGAAGAAGAGCCTCCGAAGCCCGCTCCTGCACCCGTCAAT
GTGGAAGTGAAGACCAAGTTTCCCGTCGCGCGTATAAAGCGCATCATGCAAGCCGATGAAGATGTCGGTAAAGTC
GCTCAAGTTACTCCTATCGCAGTGTCCAAAGCTCTCGAACTCTTCATGATTTCCCTCGTCACCAAAGCCGCCCGC
GAAGCCAAAGACCGCAACTCGAAACGCGTCACAGCCTCGCATCTCAAACAAGCCGTCGTTAAAGACGAAGTGCTC
GACTTCCTCGCTGACATCATCGCCAAGGTTCCTGATCAACCGGCTAGTCGGAAACACGACGACGATAACAGTGAT
CAGAATGAACAACAACCGAAACGAAAGCGCGGTGGACGTCGTCCGAAAGAAGAGAGTGATTAA
Gene >Ani_SJS100_1|g1417.t1
ATGACAGACCAAGACCAATCCTATCGTCCACGATCCCCTGATTTTTCCACCTTCCAGTCAGTTCCCCTCTCACCT
ACCTTCAACAACCACAACCTCAACCACAACGCGCACTATCAACATCCTCACCACTCCCCGGTTTACCAATTCGGG
AATCCTTTCGCCCATCGCGCTTCCTACGACGCCTCGCCGTTCTTCACCCCGCAGTATCAACCACCACCTCTACCA
CAACAACCACCATCGCTTCCTCACCACCCGGTCCCGCAGACCAGGGTTCCCCAGCAATCCTCCTCATATTTCCCT
CCCGATCCGGACATGGCTCGTCGTTCGTCGCGTATCGCCCAAGCGGCCGAGGTCGCGCCTCATCCGCCCGTCTCC
AAGTACGTCGACCCCGTCGACCCCGTCGACGAAGAGGACTATGTACCTTCACCACCACCTCAACCACAACCACAA
CCACAACCACAAGAGGAACCCGTCGCAATTATTGAGGAAGAAGAGCCTCCGAAGCCCGCTCCTGCACCCGTCAAT
GTGGAAGTGAAGACCAAGTTTCCCGTCGCGCGTATAAAGCGCATCATGCAAGCCGATGAAGATGTCGGTAAAGTC
GCTCAAGTTACTCCTATCGCAGTGTGTAAGTTGCCACCCTCATCTCAACTGATTATTGCGAAATCTTTTGAATAT
TAATGCTAATCATAATTGCCTTACAGCCAAAGCTCTCGAACTCTTCATGATTTCCCTCGTCACCAAAGCCGCCCG
CGAAGCCAAAGACCGCAACTCGAAACGCGTCACAGCCTCGCATCTCAAACAAGCCGTCGTTAAAGACGAAGTGCT
CGACTTCCTCGCTGACATCATCGCCAAGGTTCCTGATCAACCGGCTAGTCGGAAACACGACGACGATAACAGTGA
TCAGAATGAACAACAACCGAAACGAAAGCGCGGTGGACGTCGTCCGAAAGAAGAGAGTGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail