Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g1407.t1
Gene name
Locationscaffold_005:179954..181673
Strand+
Gene length (bp)1719
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.6E-33 98 492
PF00083 Sugar_tr Sugar (and other) transporter 1.7E-07 102 368

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 89 111 22
2 126 148 22
3 155 172 17
4 182 204 22
5 216 238 22
6 253 275 22
7 322 344 22
8 359 381 22
9 417 437 20
10 447 469 22
11 476 498 22
12 508 530 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g1407.t1
MQAYFQYRAIRNSVRKQLHDFPQWIHDSIGQAGSGSSLQRRPSRPPPIPGISLIDNPNSREELSHIFFVDWESSK
DPLSPRQLSLATRVAATLIVTSLAFVVSASSSIESAVVPQSTADYGVSEVVAALFVGIFLLGFATGSLISGPLSE
ILGRNAVYLVSTSLFMIFVMGSGLSPNTGAKLAFRFLAGVCGCPPLTCAGGTVADIWDSKEKTLAFPVYAILSYG
GAILAPVIASYMGSESISYRWTDWIVLIMAGLVLSLIVLVQPETYGPLLLRWKSKHLRQLTGDPRYLSKLDLDQT
PLLSRIRRACVRQFTLPIREPIVLVLSLYLTVLYIVLFAFFVGYADIFTDVHGMSQGLTNVVWVAMYVGILLTGL
IVPWIYRSHRKRGLKGDGEVSEMANETNVSEKPSTIQPEDRLWYAMMGAPAMTLSLFWMGWTDYPSISVWSPIVG
SAFFGFGSICIFISSYMYIIDTYEVYAASALGFMTSSRYCVAGGMTVVGVPFYHNMGVHWTLTILGIISAILTPV
PYILWKFGPVVRGWSRYAV*
Coding >Ani_SJS100_1|g1407.t1
ATGCAGGCATACTTTCAATATCGTGCCATTCGGAACTCAGTCCGCAAACAATTACACGACTTCCCTCAATGGATC
CACGATTCCATTGGCCAAGCAGGTTCAGGAAGCTCACTGCAGCGACGCCCATCTCGACCACCCCCGATCCCAGGA
ATTAGCCTGATCGACAACCCCAATAGCCGGGAAGAGCTCTCTCATATCTTTTTTGTCGACTGGGAAAGCAGTAAA
GACCCGCTGAGTCCACGACAACTTTCGCTCGCCACACGAGTAGCAGCAACATTGATCGTTACTAGCCTGGCATTT
GTAGTCAGCGCTTCGTCGTCGATCGAATCGGCAGTTGTGCCACAAAGCACCGCCGACTATGGGGTCAGTGAAGTC
GTAGCCGCACTTTTCGTCGGGATATTCCTCCTCGGCTTCGCTACCGGATCATTAATCTCAGGACCTCTATCAGAG
ATCCTGGGCCGCAACGCTGTCTACCTAGTTTCCACATCCCTCTTCATGATCTTCGTCATGGGCTCCGGGCTATCC
CCAAACACCGGAGCCAAGCTGGCATTTCGCTTCTTAGCGGGTGTATGTGGCTGTCCGCCCCTGACATGTGCTGGC
GGTACGGTGGCGGATATCTGGGATTCAAAAGAGAAGACATTGGCCTTTCCAGTCTATGCAATTCTTTCATACGGC
GGTGCCATCCTGGCCCCGGTTATTGCATCTTACATGGGTTCGGAGTCAATCTCGTATCGCTGGACTGACTGGATT
GTGCTCATTATGGCCGGCCTTGTCTTATCCCTTATTGTTCTTGTACAACCAGAGACATATGGTCCACTACTCCTG
CGGTGGAAATCTAAGCACCTACGGCAATTAACAGGCGATCCTCGGTACCTGTCAAAGCTGGATCTTGACCAGACT
CCACTTTTGTCTCGGATTAGACGCGCCTGCGTTCGGCAGTTCACTCTACCAATCCGGGAGCCGATCGTCCTTGTA
CTCTCGTTGTATCTGACGGTGCTGTATATTGTACTTTTCGCCTTTTTTGTCGGGTATGCCGATATCTTCACAGAC
GTACACGGTATGTCCCAGGGACTGACAAACGTCGTTTGGGTCGCTATGTACGTCGGAATCCTGCTGACGGGTTTG
ATCGTACCATGGATATATCGAAGCCATCGGAAGCGAGGGCTGAAGGGAGATGGAGAGGTATCTGAAATGGCCAAT
GAAACCAACGTCTCTGAGAAACCAAGCACAATCCAACCAGAAGATAGACTCTGGTACGCCATGATGGGTGCTCCG
GCAATGACCTTGAGTCTTTTCTGGATGGGGTGGACGGACTATCCATCTATCTCAGTATGGTCCCCAATCGTCGGC
TCAGCGTTCTTCGGCTTCGGTAGTATCTGCATCTTTATTTCCAGCTATATGTACATCATCGACACCTACGAGGTC
TATGCTGCATCTGCGCTGGGGTTCATGACTTCCTCGCGCTATTGTGTCGCTGGGGGTATGACTGTAGTCGGCGTC
CCATTCTATCATAACATGGGGGTGCATTGGACATTGACTATTTTGGGGATTATCAGTGCTATTTTGACTCCTGTG
CCCTATATTCTCTGGAAGTTCGGGCCTGTGGTTCGGGGGTGGAGTCGGTATGCTGTTTGA
Transcript >Ani_SJS100_1|g1407.t1
ATGCAGGCATACTTTCAATATCGTGCCATTCGGAACTCAGTCCGCAAACAATTACACGACTTCCCTCAATGGATC
CACGATTCCATTGGCCAAGCAGGTTCAGGAAGCTCACTGCAGCGACGCCCATCTCGACCACCCCCGATCCCAGGA
ATTAGCCTGATCGACAACCCCAATAGCCGGGAAGAGCTCTCTCATATCTTTTTTGTCGACTGGGAAAGCAGTAAA
GACCCGCTGAGTCCACGACAACTTTCGCTCGCCACACGAGTAGCAGCAACATTGATCGTTACTAGCCTGGCATTT
GTAGTCAGCGCTTCGTCGTCGATCGAATCGGCAGTTGTGCCACAAAGCACCGCCGACTATGGGGTCAGTGAAGTC
GTAGCCGCACTTTTCGTCGGGATATTCCTCCTCGGCTTCGCTACCGGATCATTAATCTCAGGACCTCTATCAGAG
ATCCTGGGCCGCAACGCTGTCTACCTAGTTTCCACATCCCTCTTCATGATCTTCGTCATGGGCTCCGGGCTATCC
CCAAACACCGGAGCCAAGCTGGCATTTCGCTTCTTAGCGGGTGTATGTGGCTGTCCGCCCCTGACATGTGCTGGC
GGTACGGTGGCGGATATCTGGGATTCAAAAGAGAAGACATTGGCCTTTCCAGTCTATGCAATTCTTTCATACGGC
GGTGCCATCCTGGCCCCGGTTATTGCATCTTACATGGGTTCGGAGTCAATCTCGTATCGCTGGACTGACTGGATT
GTGCTCATTATGGCCGGCCTTGTCTTATCCCTTATTGTTCTTGTACAACCAGAGACATATGGTCCACTACTCCTG
CGGTGGAAATCTAAGCACCTACGGCAATTAACAGGCGATCCTCGGTACCTGTCAAAGCTGGATCTTGACCAGACT
CCACTTTTGTCTCGGATTAGACGCGCCTGCGTTCGGCAGTTCACTCTACCAATCCGGGAGCCGATCGTCCTTGTA
CTCTCGTTGTATCTGACGGTGCTGTATATTGTACTTTTCGCCTTTTTTGTCGGGTATGCCGATATCTTCACAGAC
GTACACGGTATGTCCCAGGGACTGACAAACGTCGTTTGGGTCGCTATGTACGTCGGAATCCTGCTGACGGGTTTG
ATCGTACCATGGATATATCGAAGCCATCGGAAGCGAGGGCTGAAGGGAGATGGAGAGGTATCTGAAATGGCCAAT
GAAACCAACGTCTCTGAGAAACCAAGCACAATCCAACCAGAAGATAGACTCTGGTACGCCATGATGGGTGCTCCG
GCAATGACCTTGAGTCTTTTCTGGATGGGGTGGACGGACTATCCATCTATCTCAGTATGGTCCCCAATCGTCGGC
TCAGCGTTCTTCGGCTTCGGTAGTATCTGCATCTTTATTTCCAGCTATATGTACATCATCGACACCTACGAGGTC
TATGCTGCATCTGCGCTGGGGTTCATGACTTCCTCGCGCTATTGTGTCGCTGGGGGTATGACTGTAGTCGGCGTC
CCATTCTATCATAACATGGGGGTGCATTGGACATTGACTATTTTGGGGATTATCAGTGCTATTTTGACTCCTGTG
CCCTATATTCTCTGGAAGTTCGGGCCTGTGGTTCGGGGGTGGAGTCGGTATGCTGTTTGA
Gene >Ani_SJS100_1|g1407.t1
ATGCAGGCATACTTTCAATATCGTGCCATTCGGAACTCAGTCCGCAAACAATTACACGACTTCCCTCAATGGATC
CACGATTCCATTGGCCAAGCAGGTTCAGGAAGCTCACTGCAGCGACGCCCATCTCGACCACCCCCGATCCCAGGA
ATTAGCCTGATCGACAACCCCAATAGCCGGGAAGAGCTCTCTCATATCTTTTTTGTCGACTGGGAAAGCAGTAAA
GACCCGCTGAGTCCACGACAACTTTCGCTCGCCACACGAGTAGCAGCAACATTGATCGTTACTAGCCTGGCATTT
GTAGTCAGCGCTTCGTCGTCGATCGAATCGGCAGTTGTGCCACAAAGCACCGCCGACTATGGGGTCAGTGAAGTC
GTAGCCGCACTTTTCGTCGGGATATTCCTCCTCGGCTTCGCTACCGGATCATTAATCTCAGGACCTCTATCAGAG
ATCCTGGGCCGCAACGCTGTCTACCTAGTTTCCACATCCCTCTTCATGATCTTCGTCATGGGCTCCGGGCTATCC
CCAAACACCGGAGCCAAGCTGGCATTTCGCTTCTTAGCGGGTGTATGTGGCTGTCCGCCCCTGACATGTGCTGGC
GGTACGGTGGCGGATATCTGGGATTCAAAAGAGAAGACATTGGCCTTTCCAGTCTATGCAATTCTTTCATACGGC
GGTGCCATCCTGGCCCCGGTTATTGCATCTTACATGGGTTCGGAGTCAATCTCGTATCGCTGGACTGACTGGATT
GTGCTCATTATGGCCGGCCTTGTCTTATCCCTTATTGTTCTTGTACAACCAGAGACATATGGTCCACTACTCCTG
CGGTGGAAATCTAAGCACCTACGGCAATTAACAGGCGATCCTCGGTACCTGTCAAAGCTGGATCTTGACCAGACT
CCACTTTTGTCTCGGATTAGACGCGCCTGCGTTCGGCAGTTCACTCTACCAATCCGGGAGCCGATCGTCCTTGTA
CTCTCGTTGTATCTGACGGTGCTGTATATTGTACTTTTCGCCTTTTTTGTCGGGTATGCCGATATCTTCACAGAC
GTACACGGTATGTCCCAGGGACTGACAAACGTCGTTTGGGTCGCTATGTACGTCGGAATCCTGCTGACGGGTTTG
ATCGTACCATGGATATATCGAAGCCATCGGAAGCGAGGGCTGAAGGGAGATGGAGAGGTATCTGAAATGGCCAAT
GAAACCAACGTCTCTGAGAAACCAAGCACAATCCAACCAGAAGATAGACTCTGGTACGCCATGATGGGTGCTCCG
GCAATGACCTTGAGTCTTTTCTGGATGGGGTGGACGGACTATGTGAGTTGCATATGTCATCCCCAACAAGTCCCA
ATTCTTCTCCACGGTAATATACAACAGATGCTAACTTATTGCAAAATCCAGCCATCTATCTCAGTATGGTCCCCA
ATCGTCGGCTCAGCGTTCTTCGGCTTCGGTAGTATCTGCATCTTTATTTCCAGCTATATGTACATCATCGACACC
TACGAGGTCTATGCTGCATCTGCGCTGGGGTTCATGACTTCCTCGCGCTATTGTGTCGCTGGGGGTATGACTGTA
GTCGGCGTCCCATTCTATCATAACATGGGGGTGCATTGGACATTGACTATTTTGGGGATTATCAGTGCTATTTTG
ACTCCTGTGCCCTATATTCTCTGGAAGTTCGGGCCTGTGGTTCGGGGGTGGAGTCGGTATGCTGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail