Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g1281.t1
Gene name
Locationscaffold_004:620275..622358
Strand+
Gene length (bp)2083
Transcript length (bp)1815
Coding sequence length (bp)1815
Protein length (aa) 605

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain 1.2E-110 224 449
PF16886 ATP-synt_ab_Xtn ATPsynthase alpha/beta subunit N-term extension 2.5E-45 93 215
PF02874 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barrel domain 1.3E-15 15 77

GO

GO Term Description Terminal node
GO:1902600 proton transmembrane transport Yes
GO:0046034 ATP metabolic process Yes
GO:0005524 ATP binding Yes
GO:0036094 small molecule binding No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0009987 cellular process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0098662 inorganic cation transmembrane transport No
GO:0017076 purine nucleotide binding No
GO:0019637 organophosphate metabolic process No
GO:0006810 transport No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No
GO:0006793 phosphorus metabolic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0044238 primary metabolic process No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0098660 inorganic ion transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0032555 purine ribonucleotide binding No
GO:0009117 nucleotide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0098655 cation transmembrane transport No
GO:1901360 organic cyclic compound metabolic process No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0006807 nitrogen compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0055085 transmembrane transport No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0006811 ion transport No
GO:0097159 organic cyclic compound binding No
GO:0009150 purine ribonucleotide metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0043168 anion binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0051234 establishment of localization No
GO:0072521 purine-containing compound metabolic process No
GO:0006812 cation transport No
GO:0051179 localization No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0019693 ribose phosphate metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g1281.t1
MAPSADAGESQHGSVFSVSGPVVVAEHMIGCAMYELCRVGHDQLVGEVIRIDGDKATIQVYEETAGLTVGDPVTR
TGKPLSVELGPGLMETIYDGIQRPLKAISDQSKGIYIPRGIAVNALDREKKWDFTPGKYKVGDHITGGDIWGTVF
ENSLVNDHKIILPPRARGTITRIAEAGSYTVEEKLLEIEFNGVKTEHSMMHTWPVRVPRPVNEKLSSDAPFIVGQ
RVLDSLFPSVQGGTVCIPGAFGCGKTVISQSVSKFSNSDIIVYVGCGERGNEMAEVLMDFPELSIDVDGRKEPIM
KRTCLIANTSNMPVAAREASIYTGITIAEYFRDQGKNVAMMADSSSRWAEALREISGRLGEMPADQGFPAYLGAK
LASFYERAGKSNALGSPERIGSVSIVAAVSPPGGDFSDPVTSSTLGIVQVFWGLDKKLAQRKHFPSINTSISYSK
YTTVLDRYYEKHHPEFPRLRDQVRELLTKSEDLDQVVQLVGKAALGDSDKITLDVAAMVKDDFLQQNGYSDYDQF
CPLWKTEYMMKAFMGYHDEAQKAVAQGQNWSKVRDATTDIQSALRGMKFEVPSNEAEVSEKYEKILQQMSERFAS
VSDE*
Coding >Ani_SJS100_1|g1281.t1
ATGGCCCCCTCCGCTGATGCTGGCGAGAGCCAGCATGGTTCCGTCTTCTCCGTCTCCGGTCCCGTCGTCGTGGCC
GAGCATATGATCGGCTGTGCCATGTACGAGCTGTGCCGTGTTGGTCATGACCAGCTGGTCGGAGAAGTTATTCGG
ATCGATGGCGATAAGGCCACTATTCAGGTATACGAGGAGACAGCTGGTTTGACGGTCGGCGACCCCGTTACACGG
ACAGGAAAGCCCCTTTCGGTCGAGCTGGGCCCCGGTTTGATGGAAACGATCTACGATGGTATTCAGCGGCCCCTG
AAGGCGATTTCCGACCAGTCCAAGGGTATCTACATCCCACGTGGTATTGCGGTCAACGCCTTGGACCGTGAGAAG
AAGTGGGACTTCACGCCCGGCAAGTACAAGGTCGGCGATCACATCACCGGTGGTGACATCTGGGGTACCGTTTTC
GAGAACAGCTTGGTGAACGACCACAAGATCATCCTCCCTCCCCGCGCGAGGGGTACCATCACCCGCATAGCCGAA
GCTGGAAGCTACACTGTTGAGGAGAAGCTGCTGGAAATCGAGTTCAATGGAGTGAAGACGGAACACAGTATGATG
CACACCTGGCCTGTCCGTGTGCCCAGACCGGTCAACGAGAAGCTCTCGTCGGACGCTCCTTTCATCGTCGGTCAA
CGTGTGCTGGACTCTCTCTTCCCCAGTGTCCAGGGTGGTACTGTCTGTATCCCCGGTGCCTTCGGATGTGGAAAG
ACTGTCATTTCGCAGAGTGTCTCCAAATTCTCCAACAGTGATATCATTGTCTACGTCGGTTGTGGTGAGCGTGGT
AACGAGATGGCTGAAGTGTTGATGGATTTCCCCGAACTTTCTATCGACGTCGATGGCCGCAAAGAACCCATCATG
AAGCGTACCTGCTTGATCGCCAACACCTCCAACATGCCTGTCGCCGCCCGTGAGGCGTCCATCTACACCGGTATC
ACGATCGCCGAATACTTCCGTGACCAGGGCAAGAACGTGGCTATGATGGCGGACTCCAGTTCCCGCTGGGCTGAG
GCTCTTCGTGAAATTTCCGGTCGTCTGGGAGAGATGCCGGCTGATCAGGGTTTCCCTGCCTACCTGGGTGCCAAG
CTGGCTTCCTTCTACGAGCGTGCCGGTAAGAGTAACGCCTTGGGTAGCCCCGAGAGAATTGGTAGTGTCAGTATT
GTAGCTGCCGTCAGCCCTCCGGGTGGTGACTTCTCTGATCCCGTCACCAGTAGTACCCTGGGTATCGTCCAGGTG
TTCTGGGGTCTGGACAAGAAGTTGGCTCAACGTAAACATTTCCCGTCGATCAACACATCGATCTCTTACAGCAAG
TACACGACGGTTCTGGACCGGTACTACGAGAAGCATCATCCCGAGTTCCCTCGCCTGCGTGACCAGGTCAGAGAG
CTTCTGACCAAGTCGGAGGATCTGGACCAGGTCGTGCAGCTGGTTGGTAAGGCAGCTCTGGGTGACTCTGACAAG
ATTACTCTGGATGTGGCGGCCATGGTCAAGGATGACTTCCTGCAGCAGAACGGTTACAGTGACTACGATCAGTTC
TGCCCGCTGTGGAAGACCGAGTACATGATGAAGGCGTTCATGGGCTACCACGATGAAGCCCAGAAGGCTGTTGCC
CAGGGCCAGAACTGGTCCAAGGTTCGCGACGCCACTACCGACATTCAGAGCGCGCTCCGGGGTATGAAGTTCGAG
GTGCCGAGCAACGAAGCGGAAGTTTCCGAGAAGTACGAGAAGATCCTCCAGCAAATGTCGGAGCGGTTTGCTTCG
GTGTCGGATGAGTAG
Transcript >Ani_SJS100_1|g1281.t1
ATGGCCCCCTCCGCTGATGCTGGCGAGAGCCAGCATGGTTCCGTCTTCTCCGTCTCCGGTCCCGTCGTCGTGGCC
GAGCATATGATCGGCTGTGCCATGTACGAGCTGTGCCGTGTTGGTCATGACCAGCTGGTCGGAGAAGTTATTCGG
ATCGATGGCGATAAGGCCACTATTCAGGTATACGAGGAGACAGCTGGTTTGACGGTCGGCGACCCCGTTACACGG
ACAGGAAAGCCCCTTTCGGTCGAGCTGGGCCCCGGTTTGATGGAAACGATCTACGATGGTATTCAGCGGCCCCTG
AAGGCGATTTCCGACCAGTCCAAGGGTATCTACATCCCACGTGGTATTGCGGTCAACGCCTTGGACCGTGAGAAG
AAGTGGGACTTCACGCCCGGCAAGTACAAGGTCGGCGATCACATCACCGGTGGTGACATCTGGGGTACCGTTTTC
GAGAACAGCTTGGTGAACGACCACAAGATCATCCTCCCTCCCCGCGCGAGGGGTACCATCACCCGCATAGCCGAA
GCTGGAAGCTACACTGTTGAGGAGAAGCTGCTGGAAATCGAGTTCAATGGAGTGAAGACGGAACACAGTATGATG
CACACCTGGCCTGTCCGTGTGCCCAGACCGGTCAACGAGAAGCTCTCGTCGGACGCTCCTTTCATCGTCGGTCAA
CGTGTGCTGGACTCTCTCTTCCCCAGTGTCCAGGGTGGTACTGTCTGTATCCCCGGTGCCTTCGGATGTGGAAAG
ACTGTCATTTCGCAGAGTGTCTCCAAATTCTCCAACAGTGATATCATTGTCTACGTCGGTTGTGGTGAGCGTGGT
AACGAGATGGCTGAAGTGTTGATGGATTTCCCCGAACTTTCTATCGACGTCGATGGCCGCAAAGAACCCATCATG
AAGCGTACCTGCTTGATCGCCAACACCTCCAACATGCCTGTCGCCGCCCGTGAGGCGTCCATCTACACCGGTATC
ACGATCGCCGAATACTTCCGTGACCAGGGCAAGAACGTGGCTATGATGGCGGACTCCAGTTCCCGCTGGGCTGAG
GCTCTTCGTGAAATTTCCGGTCGTCTGGGAGAGATGCCGGCTGATCAGGGTTTCCCTGCCTACCTGGGTGCCAAG
CTGGCTTCCTTCTACGAGCGTGCCGGTAAGAGTAACGCCTTGGGTAGCCCCGAGAGAATTGGTAGTGTCAGTATT
GTAGCTGCCGTCAGCCCTCCGGGTGGTGACTTCTCTGATCCCGTCACCAGTAGTACCCTGGGTATCGTCCAGGTG
TTCTGGGGTCTGGACAAGAAGTTGGCTCAACGTAAACATTTCCCGTCGATCAACACATCGATCTCTTACAGCAAG
TACACGACGGTTCTGGACCGGTACTACGAGAAGCATCATCCCGAGTTCCCTCGCCTGCGTGACCAGGTCAGAGAG
CTTCTGACCAAGTCGGAGGATCTGGACCAGGTCGTGCAGCTGGTTGGTAAGGCAGCTCTGGGTGACTCTGACAAG
ATTACTCTGGATGTGGCGGCCATGGTCAAGGATGACTTCCTGCAGCAGAACGGTTACAGTGACTACGATCAGTTC
TGCCCGCTGTGGAAGACCGAGTACATGATGAAGGCGTTCATGGGCTACCACGATGAAGCCCAGAAGGCTGTTGCC
CAGGGCCAGAACTGGTCCAAGGTTCGCGACGCCACTACCGACATTCAGAGCGCGCTCCGGGGTATGAAGTTCGAG
GTGCCGAGCAACGAAGCGGAAGTTTCCGAGAAGTACGAGAAGATCCTCCAGCAAATGTCGGAGCGGTTTGCTTCG
GTGTCGGATGAGTAG
Gene >Ani_SJS100_1|g1281.t1
ATGGCCCCCTCCGCTGATGCTGGCGAGAGCCAGCATGGTTCCGTCTTCTCCGTCTCCGGTCCCGTCGTCGTGGCC
GAGCATATGATCGGCTGTGCCATGTACGAGCTGGTATGCTTCCATGTGTTTCTTCGTCGATATATACTGCGCTTC
TAGGTTTACGCATCTGCAAATACCGATCGCTAACTCCGGGCATCGACTGTAGTGCCGTGTTGGTCATGACCAGCT
GGTCGGAGAAGTTATTCGGATCGATGGCGATAAGGCCACTATTCAGGTATACGAGGAGACAGGTACACCCACCAA
CTCGTCCTGTCTTTCCACAACACCCTCGTCTAACTGCAACTCTCTTTAGCTGGTTTGACGGTCGGCGACCCCGTT
ACACGGACAGGAAAGCCCCTTTCGGTCGAGCTGGGCCCCGGTTTGATGGAAACGATCTACGATGGTATTCAGCGG
CCCCTGAAGGCGATTTCCGACCAGTCCAAGGGTATCTACATCCCACGTGGTATTGCGGTCAACGCCTTGGACCGT
GAGAAGAAGTGGGACTTCACGCCCGGCAAGTACAAGGTCGGCGATCACATCACCGGTGGTGACATCTGGGGTACC
GTTTTCGAGAACAGCTTGGTGAACGACCACAAGATCATCCTCCCTCCCCGCGCGAGGGGTACCATCACCCGCATA
GCCGAAGCTGGAAGCTACACTGTTGAGGAGAAGCTGCTGGAAATCGAGTTCAATGGAGTGAAGACGGAACACAGT
ATGATGCACACCTGGCCTGTCCGTGTGCCCAGACCGGTCAACGAGAAGCTCTCGTCGGACGCTCCTTTCATCGTC
GGTCAACGTGTGCTGGACTCTCTCTTCCCCAGTGTCCAGGGTGGTACTGTCTGTATCCCCGGTGCCTTCGGATGT
GGAAAGACTGTCATTTCGCAGAGTGTCTCCAAATTCTCCAACAGTGATATCATTGTCTACGTCGGTTGTGGTGAG
CGTGGTAACGAGATGGCTGAAGTGTTGATGGATTTCCCCGAAGTTAGTGCCCCGTCCTACAGTAAATCTTCATGA
CTAACGAGCGACCGCAATATTAATAGCTTTCTATCGACGTCGATGGCCGCAAAGAACCCATCATGAAGCGTACCT
GCTTGATCGCCAACACCTCCAACATGCCTGTCGCCGCCCGTGAGGCGTCCATCTACACCGGTATCACGATCGCCG
AATACTTCCGTGACCAGGGCAAGAACGTGGCTATGATGGCGGACTCCAGTTCCCGCTGGGCTGAGGCTCTTCGTG
AAATTTCCGGTCGTCTGGGAGAGATGCCGGCTGATCAGGGTTTCCCTGCCTACCTGGGTGCCAAGCTGGCTTCCT
TCTACGAGCGTGCCGGTAAGAGTAACGCCTTGGGTAGCCCCGAGAGAATTGGTAGTGTCAGTATTGTAGCTGCCG
TCAGCCCTCCGGGTGGTGACTTCTCTGATCCCGTCACCAGTAGTACCCTGGGTATCGTCCAGGTGTTCTGGGGTC
TGGACAAGAAGTTGGCTCAACGTAAACATTTCCCGTCGATCAACACATCGATCTCTTACAGCAAGTACACGACGG
TTCTGGACCGGTACTACGAGAAGCATCATCCCGAGTTCCCTCGCCTGCGTGACCAGGTCAGAGAGCTTCTGACCA
AGTCGGAGGATCTGGACCAGGTCGTGCAGCTGGTTGGTAAGGCAGCTCTGGGTGACTCTGACAAGATTACTCTGG
ATGTGGCGGCCATGGTCAAGGATGACTTCCTGCAGCAGAACGGTTACAGTGACTACGATCAGTTCTGCCCGCTGT
GGAAGACCGAGTACATGATGAAGGCGTTCATGGGCTACCACGATGAAGCCCAGAAGGCTGTTGCCCAGGGCCAGA
ACTGGTCCAAGGTTCGCGACGCCACTACCGACATTCAGAGCGCGCTCCGGGGTATGAAGTTCGAGGTGCCGAGCA
ACGAAGCGGAAGTTTCCGAGAAGGTAAGCCAGATGCCACCGCTCTTAGCTATTCTGTGTTCTAACTCTGTTTGCA
GTACGAGAAGATCCTCCAGCAAATGTCGGAGCGGTTTGCTTCGGTGTCGGATGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail