Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g1255.t1
Gene name
Locationscaffold_004:536182..538969
Strand-
Gene length (bp)2787
Transcript length (bp)2787
Coding sequence length (bp)2787
Protein length (aa) 929

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.2E-55 32 443
PF00975 Thioesterase Thioesterase domain 2.8E-22 666 917
PF00550 PP-binding Phosphopantetheine attachment site 4.9E-12 579 642

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g1255.t1
MTVNSITDILRKAADHQEPRGVCAYSTGIAGIGSATRLSYTELDSLATSNAILLGRLQCDTESPVILLHFEDHLD
NIIWFWSTLYAGYIPAMSTALPRSEEHRTRHLCHLSELFDKPICLTRKTLQNLLTRESPLHVVAIESLNGSSAEF
VATTEAISRAPVNSGGGHPALLMLTSGSTGLPKTVSLTHNQILASLQGKSHSLCVEDTGDSFLNWIRLDHVGSFI
EIHLHALFVGYDQVHVPPNEIISRPALFLDLISRHRVVRTFAPNFFLAEVGRYLETSQGEDRPHFDLRCLRYIVS
GGEAVVASTCAKVSRLLVQHGAPENVIVPGFGMTETCAGCIYNLEFPAFDTRNENEFASLGKCVPGVQARIVSIA
TGDSPAALGEEGQLELRGPLVFSGYYNNQAATSEAIGPDGWFRTGDTGYIGAGGRINLSGRTKELIAVNGVKYVP
HQLEAAIEEASIPGIVSGCVICFSFRPKGAETERPCVIYQHTYCVNDAKARYQTMTAISHRITMITNMRPYILPL
QTVKRTSLGKLPRSSLQREVASGQYKMKEAIDREMIKKYRQAIFRPPESPTEKVIVEELSELLSLPQEDIGIDTD
LFELGLTSLTLIRLQQALRTRLSLNEPIPLATMIAHNTVRGLFEACQQHHQYIPAVKLQSSGNKTPLWLVHPAAG
EALIFINIAKLITDRPVYAFRARGFHHNEPYFTSIDECIRTYHSSMKKLQPHGPYAILGYSYGTMLAFELAKSLE
KAGDQVQYLAGLNRPPYVSPVLKRVTWTDCLVNISYFLGLLSRDSYRTLLREISVFPKHDALARVIEKVDPGQLL
ALGLDEGSLEQWINVAFSLQEIGREYEPRGVVNAHMDVFHCTPLEFLNVTPEEWKRRLAAWENFSRQKVNLRHVP
GDHANVLGPDHVQVFVKKLGEAMALQGL*
Coding >Ani_SJS100_1|g1255.t1
ATGACCGTGAATTCTATAACAGACATCCTCCGCAAAGCAGCAGACCATCAGGAACCTCGTGGTGTCTGTGCCTAT
TCGACCGGCATCGCTGGGATCGGTTCCGCAACGAGGTTAAGTTACACAGAGCTCGATTCATTGGCCACATCGAAT
GCTATACTACTAGGGCGGCTGCAGTGCGACACCGAGTCTCCTGTCATACTACTTCACTTTGAAGACCATCTGGAC
AATATCATATGGTTTTGGTCTACCTTATATGCAGGCTACATTCCTGCAATGTCCACTGCTCTGCCTCGAAGTGAA
GAACACCGCACAAGGCATCTCTGCCATCTAAGCGAGCTGTTCGATAAGCCTATCTGTCTAACTCGGAAAACCCTC
CAAAACCTGCTTACAAGAGAGTCTCCCTTGCACGTTGTGGCTATAGAATCATTGAATGGTTCATCAGCAGAGTTT
GTCGCTACGACAGAAGCCATTTCCAGAGCACCAGTAAATAGCGGTGGTGGGCATCCTGCTCTGCTGATGCTCACA
TCTGGAAGTACTGGTCTGCCAAAAACCGTGTCTCTAACACACAACCAGATACTGGCCTCCCTCCAAGGGAAAAGC
CATTCGCTATGTGTTGAGGACACTGGTGATTCGTTCTTGAATTGGATTCGGCTCGACCACGTCGGGAGTTTCATC
GAAATCCATCTCCATGCACTATTTGTCGGGTACGACCAAGTTCACGTTCCGCCTAACGAGATAATATCTCGTCCG
GCCTTGTTCCTCGACCTCATAAGTCGACATCGTGTAGTTAGGACGTTCGCGCCCAACTTTTTCCTCGCTGAAGTT
GGCCGTTATTTGGAGACCTCCCAAGGAGAAGATAGACCTCACTTTGACTTGAGATGTCTACGATACATCGTATCT
GGTGGGGAGGCTGTTGTTGCCAGTACTTGTGCCAAAGTTTCTCGATTGCTGGTCCAACACGGCGCACCTGAAAAT
GTCATCGTTCCTGGATTCGGCATGACTGAGACTTGCGCAGGGTGCATCTACAACTTGGAATTTCCTGCGTTTGAT
ACTCGCAACGAAAATGAGTTTGCTTCCCTGGGAAAGTGTGTCCCGGGCGTTCAGGCACGGATCGTCTCCATAGCT
ACGGGTGACAGTCCCGCGGCCTTAGGAGAGGAAGGCCAGCTGGAACTCAGAGGTCCGCTTGTATTTTCTGGTTAT
TACAACAATCAAGCAGCAACCAGTGAGGCTATCGGCCCCGATGGTTGGTTTCGAACTGGGGATACGGGTTACATC
GGCGCGGGCGGCAGGATAAATCTGTCGGGTAGGACTAAAGAATTGATCGCCGTCAACGGTGTCAAATATGTTCCG
CATCAGCTGGAAGCCGCTATAGAGGAAGCAAGCATACCAGGTATTGTTTCTGGCTGTGTGATATGCTTCTCATTC
CGTCCCAAGGGTGCAGAGACAGAGCGACCTTGCGTCATCTACCAGCATACCTATTGCGTTAACGATGCTAAAGCT
AGATATCAGACGATGACTGCCATCTCGCACCGTATCACGATGATAACAAATATGCGCCCGTATATATTGCCTTTA
CAGACTGTAAAACGCACATCCTTAGGGAAGCTTCCTCGCTCTAGCCTGCAGCGGGAGGTTGCAAGTGGTCAGTAC
AAAATGAAAGAAGCTATCGACAGAGAAATGATCAAGAAGTATCGACAAGCCATTTTCAGGCCACCCGAGTCACCT
ACCGAAAAAGTGATCGTGGAAGAGCTGTCAGAACTCCTGTCCCTACCTCAAGAAGACATCGGAATCGACACCGAC
CTCTTCGAACTAGGCCTTACCTCATTAACGCTTATCCGGCTCCAACAGGCCTTGCGAACAAGGCTGTCACTAAAT
GAGCCAATCCCTCTCGCCACGATGATTGCCCATAACACTGTCCGTGGTTTATTTGAAGCATGCCAACAACATCAC
CAATACATCCCAGCCGTGAAGCTCCAATCCAGCGGCAACAAGACACCTCTATGGCTCGTACACCCTGCCGCAGGC
GAAGCCCTCATATTCATCAACATAGCCAAGCTCATCACAGACCGACCCGTCTACGCATTCCGGGCCCGCGGATTC
CACCACAATGAGCCATATTTCACCAGCATTGACGAATGCATCCGCACTTACCACTCCTCCATGAAGAAGCTTCAA
CCGCACGGCCCTTACGCTATCCTCGGATACTCCTACGGCACGATGCTAGCATTTGAACTTGCCAAGTCCCTCGAG
AAAGCAGGTGACCAAGTCCAATACCTTGCCGGCCTTAACCGTCCTCCATATGTTAGTCCAGTCCTGAAGAGAGTT
ACATGGACCGACTGCCTAGTTAACATCTCCTACTTCCTCGGCCTTCTTTCTCGAGACTCATACCGGACTCTCCTC
CGGGAGATCTCTGTGTTTCCGAAGCATGATGCCTTGGCCAGAGTGATCGAGAAAGTGGATCCTGGCCAACTCCTG
GCGTTGGGCCTCGATGAAGGTAGCCTAGAACAGTGGATCAATGTTGCCTTCAGCCTACAGGAGATAGGAAGAGAA
TATGAGCCGCGTGGAGTGGTAAATGCACATATGGATGTCTTTCATTGCACTCCATTGGAGTTCCTGAATGTTACA
CCTGAAGAATGGAAGCGACGTCTGGCTGCTTGGGAGAATTTCTCCAGACAGAAGGTGAACCTGAGACATGTACCA
GGTGACCATGCTAATGTCTTGGGACCGGATCATGTGCAGGTGTTTGTGAAGAAGTTGGGTGAGGCTATGGCGTTG
CAGGGTCTTTAG
Transcript >Ani_SJS100_1|g1255.t1
ATGACCGTGAATTCTATAACAGACATCCTCCGCAAAGCAGCAGACCATCAGGAACCTCGTGGTGTCTGTGCCTAT
TCGACCGGCATCGCTGGGATCGGTTCCGCAACGAGGTTAAGTTACACAGAGCTCGATTCATTGGCCACATCGAAT
GCTATACTACTAGGGCGGCTGCAGTGCGACACCGAGTCTCCTGTCATACTACTTCACTTTGAAGACCATCTGGAC
AATATCATATGGTTTTGGTCTACCTTATATGCAGGCTACATTCCTGCAATGTCCACTGCTCTGCCTCGAAGTGAA
GAACACCGCACAAGGCATCTCTGCCATCTAAGCGAGCTGTTCGATAAGCCTATCTGTCTAACTCGGAAAACCCTC
CAAAACCTGCTTACAAGAGAGTCTCCCTTGCACGTTGTGGCTATAGAATCATTGAATGGTTCATCAGCAGAGTTT
GTCGCTACGACAGAAGCCATTTCCAGAGCACCAGTAAATAGCGGTGGTGGGCATCCTGCTCTGCTGATGCTCACA
TCTGGAAGTACTGGTCTGCCAAAAACCGTGTCTCTAACACACAACCAGATACTGGCCTCCCTCCAAGGGAAAAGC
CATTCGCTATGTGTTGAGGACACTGGTGATTCGTTCTTGAATTGGATTCGGCTCGACCACGTCGGGAGTTTCATC
GAAATCCATCTCCATGCACTATTTGTCGGGTACGACCAAGTTCACGTTCCGCCTAACGAGATAATATCTCGTCCG
GCCTTGTTCCTCGACCTCATAAGTCGACATCGTGTAGTTAGGACGTTCGCGCCCAACTTTTTCCTCGCTGAAGTT
GGCCGTTATTTGGAGACCTCCCAAGGAGAAGATAGACCTCACTTTGACTTGAGATGTCTACGATACATCGTATCT
GGTGGGGAGGCTGTTGTTGCCAGTACTTGTGCCAAAGTTTCTCGATTGCTGGTCCAACACGGCGCACCTGAAAAT
GTCATCGTTCCTGGATTCGGCATGACTGAGACTTGCGCAGGGTGCATCTACAACTTGGAATTTCCTGCGTTTGAT
ACTCGCAACGAAAATGAGTTTGCTTCCCTGGGAAAGTGTGTCCCGGGCGTTCAGGCACGGATCGTCTCCATAGCT
ACGGGTGACAGTCCCGCGGCCTTAGGAGAGGAAGGCCAGCTGGAACTCAGAGGTCCGCTTGTATTTTCTGGTTAT
TACAACAATCAAGCAGCAACCAGTGAGGCTATCGGCCCCGATGGTTGGTTTCGAACTGGGGATACGGGTTACATC
GGCGCGGGCGGCAGGATAAATCTGTCGGGTAGGACTAAAGAATTGATCGCCGTCAACGGTGTCAAATATGTTCCG
CATCAGCTGGAAGCCGCTATAGAGGAAGCAAGCATACCAGGTATTGTTTCTGGCTGTGTGATATGCTTCTCATTC
CGTCCCAAGGGTGCAGAGACAGAGCGACCTTGCGTCATCTACCAGCATACCTATTGCGTTAACGATGCTAAAGCT
AGATATCAGACGATGACTGCCATCTCGCACCGTATCACGATGATAACAAATATGCGCCCGTATATATTGCCTTTA
CAGACTGTAAAACGCACATCCTTAGGGAAGCTTCCTCGCTCTAGCCTGCAGCGGGAGGTTGCAAGTGGTCAGTAC
AAAATGAAAGAAGCTATCGACAGAGAAATGATCAAGAAGTATCGACAAGCCATTTTCAGGCCACCCGAGTCACCT
ACCGAAAAAGTGATCGTGGAAGAGCTGTCAGAACTCCTGTCCCTACCTCAAGAAGACATCGGAATCGACACCGAC
CTCTTCGAACTAGGCCTTACCTCATTAACGCTTATCCGGCTCCAACAGGCCTTGCGAACAAGGCTGTCACTAAAT
GAGCCAATCCCTCTCGCCACGATGATTGCCCATAACACTGTCCGTGGTTTATTTGAAGCATGCCAACAACATCAC
CAATACATCCCAGCCGTGAAGCTCCAATCCAGCGGCAACAAGACACCTCTATGGCTCGTACACCCTGCCGCAGGC
GAAGCCCTCATATTCATCAACATAGCCAAGCTCATCACAGACCGACCCGTCTACGCATTCCGGGCCCGCGGATTC
CACCACAATGAGCCATATTTCACCAGCATTGACGAATGCATCCGCACTTACCACTCCTCCATGAAGAAGCTTCAA
CCGCACGGCCCTTACGCTATCCTCGGATACTCCTACGGCACGATGCTAGCATTTGAACTTGCCAAGTCCCTCGAG
AAAGCAGGTGACCAAGTCCAATACCTTGCCGGCCTTAACCGTCCTCCATATGTTAGTCCAGTCCTGAAGAGAGTT
ACATGGACCGACTGCCTAGTTAACATCTCCTACTTCCTCGGCCTTCTTTCTCGAGACTCATACCGGACTCTCCTC
CGGGAGATCTCTGTGTTTCCGAAGCATGATGCCTTGGCCAGAGTGATCGAGAAAGTGGATCCTGGCCAACTCCTG
GCGTTGGGCCTCGATGAAGGTAGCCTAGAACAGTGGATCAATGTTGCCTTCAGCCTACAGGAGATAGGAAGAGAA
TATGAGCCGCGTGGAGTGGTAAATGCACATATGGATGTCTTTCATTGCACTCCATTGGAGTTCCTGAATGTTACA
CCTGAAGAATGGAAGCGACGTCTGGCTGCTTGGGAGAATTTCTCCAGACAGAAGGTGAACCTGAGACATGTACCA
GGTGACCATGCTAATGTCTTGGGACCGGATCATGTGCAGGTGTTTGTGAAGAAGTTGGGTGAGGCTATGGCGTTG
CAGGGTCTTTAG
Gene >Ani_SJS100_1|g1255.t1
ATGACCGTGAATTCTATAACAGACATCCTCCGCAAAGCAGCAGACCATCAGGAACCTCGTGGTGTCTGTGCCTAT
TCGACCGGCATCGCTGGGATCGGTTCCGCAACGAGGTTAAGTTACACAGAGCTCGATTCATTGGCCACATCGAAT
GCTATACTACTAGGGCGGCTGCAGTGCGACACCGAGTCTCCTGTCATACTACTTCACTTTGAAGACCATCTGGAC
AATATCATATGGTTTTGGTCTACCTTATATGCAGGCTACATTCCTGCAATGTCCACTGCTCTGCCTCGAAGTGAA
GAACACCGCACAAGGCATCTCTGCCATCTAAGCGAGCTGTTCGATAAGCCTATCTGTCTAACTCGGAAAACCCTC
CAAAACCTGCTTACAAGAGAGTCTCCCTTGCACGTTGTGGCTATAGAATCATTGAATGGTTCATCAGCAGAGTTT
GTCGCTACGACAGAAGCCATTTCCAGAGCACCAGTAAATAGCGGTGGTGGGCATCCTGCTCTGCTGATGCTCACA
TCTGGAAGTACTGGTCTGCCAAAAACCGTGTCTCTAACACACAACCAGATACTGGCCTCCCTCCAAGGGAAAAGC
CATTCGCTATGTGTTGAGGACACTGGTGATTCGTTCTTGAATTGGATTCGGCTCGACCACGTCGGGAGTTTCATC
GAAATCCATCTCCATGCACTATTTGTCGGGTACGACCAAGTTCACGTTCCGCCTAACGAGATAATATCTCGTCCG
GCCTTGTTCCTCGACCTCATAAGTCGACATCGTGTAGTTAGGACGTTCGCGCCCAACTTTTTCCTCGCTGAAGTT
GGCCGTTATTTGGAGACCTCCCAAGGAGAAGATAGACCTCACTTTGACTTGAGATGTCTACGATACATCGTATCT
GGTGGGGAGGCTGTTGTTGCCAGTACTTGTGCCAAAGTTTCTCGATTGCTGGTCCAACACGGCGCACCTGAAAAT
GTCATCGTTCCTGGATTCGGCATGACTGAGACTTGCGCAGGGTGCATCTACAACTTGGAATTTCCTGCGTTTGAT
ACTCGCAACGAAAATGAGTTTGCTTCCCTGGGAAAGTGTGTCCCGGGCGTTCAGGCACGGATCGTCTCCATAGCT
ACGGGTGACAGTCCCGCGGCCTTAGGAGAGGAAGGCCAGCTGGAACTCAGAGGTCCGCTTGTATTTTCTGGTTAT
TACAACAATCAAGCAGCAACCAGTGAGGCTATCGGCCCCGATGGTTGGTTTCGAACTGGGGATACGGGTTACATC
GGCGCGGGCGGCAGGATAAATCTGTCGGGTAGGACTAAAGAATTGATCGCCGTCAACGGTGTCAAATATGTTCCG
CATCAGCTGGAAGCCGCTATAGAGGAAGCAAGCATACCAGGTATTGTTTCTGGCTGTGTGATATGCTTCTCATTC
CGTCCCAAGGGTGCAGAGACAGAGCGACCTTGCGTCATCTACCAGCATACCTATTGCGTTAACGATGCTAAAGCT
AGATATCAGACGATGACTGCCATCTCGCACCGTATCACGATGATAACAAATATGCGCCCGTATATATTGCCTTTA
CAGACTGTAAAACGCACATCCTTAGGGAAGCTTCCTCGCTCTAGCCTGCAGCGGGAGGTTGCAAGTGGTCAGTAC
AAAATGAAAGAAGCTATCGACAGAGAAATGATCAAGAAGTATCGACAAGCCATTTTCAGGCCACCCGAGTCACCT
ACCGAAAAAGTGATCGTGGAAGAGCTGTCAGAACTCCTGTCCCTACCTCAAGAAGACATCGGAATCGACACCGAC
CTCTTCGAACTAGGCCTTACCTCATTAACGCTTATCCGGCTCCAACAGGCCTTGCGAACAAGGCTGTCACTAAAT
GAGCCAATCCCTCTCGCCACGATGATTGCCCATAACACTGTCCGTGGTTTATTTGAAGCATGCCAACAACATCAC
CAATACATCCCAGCCGTGAAGCTCCAATCCAGCGGCAACAAGACACCTCTATGGCTCGTACACCCTGCCGCAGGC
GAAGCCCTCATATTCATCAACATAGCCAAGCTCATCACAGACCGACCCGTCTACGCATTCCGGGCCCGCGGATTC
CACCACAATGAGCCATATTTCACCAGCATTGACGAATGCATCCGCACTTACCACTCCTCCATGAAGAAGCTTCAA
CCGCACGGCCCTTACGCTATCCTCGGATACTCCTACGGCACGATGCTAGCATTTGAACTTGCCAAGTCCCTCGAG
AAAGCAGGTGACCAAGTCCAATACCTTGCCGGCCTTAACCGTCCTCCATATGTTAGTCCAGTCCTGAAGAGAGTT
ACATGGACCGACTGCCTAGTTAACATCTCCTACTTCCTCGGCCTTCTTTCTCGAGACTCATACCGGACTCTCCTC
CGGGAGATCTCTGTGTTTCCGAAGCATGATGCCTTGGCCAGAGTGATCGAGAAAGTGGATCCTGGCCAACTCCTG
GCGTTGGGCCTCGATGAAGGTAGCCTAGAACAGTGGATCAATGTTGCCTTCAGCCTACAGGAGATAGGAAGAGAA
TATGAGCCGCGTGGAGTGGTAAATGCACATATGGATGTCTTTCATTGCACTCCATTGGAGTTCCTGAATGTTACA
CCTGAAGAATGGAAGCGACGTCTGGCTGCTTGGGAGAATTTCTCCAGACAGAAGGTGAACCTGAGACATGTACCA
GGTGACCATGCTAATGTCTTGGGACCGGATCATGTGCAGGTGTTTGTGAAGAAGTTGGGTGAGGCTATGGCGTTG
CAGGGTCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail