Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g11707.t1
Gene name
Locationscaffold_354:5303..6204
Strand-
Gene length (bp)901
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 5 22 17
2 32 49 17
3 56 74 18
4 89 111 22
5 118 137 19
6 147 169 22
7 181 200 19
8 215 237 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g11707.t1
MPMDWAGAALFFCSLLLIFFAINECSHALDGWRTPYAYVTLIVGFFVLLAALYRPYSSGLFCFCGVFGIWLLYAV
EYMENIMHVSPLVMVAYFAPFALGGILFSLLRGLFLHVLPGTVLLVVSGIGWLMAPLLFAIMPRGAGYWPYVFPA
MICGTLGMDVTYNVTNIFVTASLPQRQQRLAAAVANSVIFLGISFWLGWGDFTSAQVDGDSRARYQAPLWIAEGL
AGLGLITTVLFVKIKPAKSEVTVDEKEGNSGETEVPKEEMDVEVNEQAAIVLQ*
Coding >Ani_SJS100_1|g11707.t1
ATGCCCATGGATTGGGCCGGGGCCGCCCTCTTCTTCTGCAGTCTTCTGCTGATCTTTTTCGCCATCAACGAATGC
AGTCATGCACTCGACGGCTGGCGCACACCCTACGCCTATGTTACGTTGATAGTGGGTTTTTTCGTGCTGCTGGCG
GCGCTTTATCGTCCTTACTCCTCGGGACTGTTCTGTTTCTGCGGCGTGTTTGGCATCTGGCTACTTTATGCTGTG
GAGTACATGGAGAACATTATGCACGTCTCGCCCCTGGTCATGGTGGCGTACTTTGCCCCCTTCGCATTAGGTGGC
ATCCTCTTTAGCCTGCTTCGGGGTTTGTTTCTGCATGTTCTCCCAGGCACAGTGCTTCTTGTAGTTTCGGGCATT
GGATGGCTGATGGCACCGCTACTTTTCGCTATCATGCCGCGCGGGGCCGGCTACTGGCCCTACGTGTTTCCAGCC
ATGATCTGCGGCACCTTGGGCATGGATGTCACATACAATGTCACTAATATCTTCGTTACCGCCTCTCTGCCCCAG
CGACAACAGCGGCTGGCCGCTGCCGTCGCCAATAGCGTTATATTCCTAGGCATCAGTTTCTGGCTGGGGTGGGGT
GACTTTACCTCAGCACAAGTGGATGGAGACTCGCGCGCGAGGTACCAGGCCCCACTCTGGATAGCGGAGGGGTTG
GCTGGACTGGGACTGATCACCACGGTGCTCTTCGTGAAGATCAAGCCCGCCAAGAGTGAAGTGACTGTAGATGAG
AAGGAGGGGAACTCGGGAGAAACGGAGGTGCCCAAGGAAGAAATGGACGTTGAGGTGAATGAACAGGCTGCGATT
GTCTTGCAATGA
Transcript >Ani_SJS100_1|g11707.t1
ATGCCCATGGATTGGGCCGGGGCCGCCCTCTTCTTCTGCAGTCTTCTGCTGATCTTTTTCGCCATCAACGAATGC
AGTCATGCACTCGACGGCTGGCGCACACCCTACGCCTATGTTACGTTGATAGTGGGTTTTTTCGTGCTGCTGGCG
GCGCTTTATCGTCCTTACTCCTCGGGACTGTTCTGTTTCTGCGGCGTGTTTGGCATCTGGCTACTTTATGCTGTG
GAGTACATGGAGAACATTATGCACGTCTCGCCCCTGGTCATGGTGGCGTACTTTGCCCCCTTCGCATTAGGTGGC
ATCCTCTTTAGCCTGCTTCGGGGTTTGTTTCTGCATGTTCTCCCAGGCACAGTGCTTCTTGTAGTTTCGGGCATT
GGATGGCTGATGGCACCGCTACTTTTCGCTATCATGCCGCGCGGGGCCGGCTACTGGCCCTACGTGTTTCCAGCC
ATGATCTGCGGCACCTTGGGCATGGATGTCACATACAATGTCACTAATATCTTCGTTACCGCCTCTCTGCCCCAG
CGACAACAGCGGCTGGCCGCTGCCGTCGCCAATAGCGTTATATTCCTAGGCATCAGTTTCTGGCTGGGGTGGGGT
GACTTTACCTCAGCACAAGTGGATGGAGACTCGCGCGCGAGGTACCAGGCCCCACTCTGGATAGCGGAGGGGTTG
GCTGGACTGGGACTGATCACCACGGTGCTCTTCGTGAAGATCAAGCCCGCCAAGAGTGAAGTGACTGTAGATGAG
AAGGAGGGGAACTCGGGAGAAACGGAGGTGCCCAAGGAAGAAATGGACGTTGAGGTGAATGAACAGGCTGCGATT
GTCTTGCAATGA
Gene >Ani_SJS100_1|g11707.t1
ATGCCCATGGATTGGGCCGGGGCCGCCCTCTTCTTCTGCAGTCTTCTGCTGATCTTTTTCGCCATCAACGAATGC
AGTCATGCACTCGACGGCTGGCGCACACCCTACGCCTATGTTACGTTGATAGTGGGTTTTTTCGTGCTGCTGGCG
GCGCTGTACGTCGAAGGCTGGGTATCCAAGGAGCCACTACTTCCACTTGGTCTCTTCCGGATCCCCCAGTTATCG
TCCTTACTCCTCGGGACTGTTCTGTTTCTGCGGCGTGTTTGGCATCTGGCTACTTTATGCTGTGGAGTACATGGA
GAACATTATGCACGTCTCGCCCCTGGTCATGGTGGCGTACTTTGCCCCCTTCGCATTAGGTGGCATCCTCTTTAG
CCTGCTTCGGGGTTTGTTTCTGCATGTTCTCCCAGGCACAGTGCTTCTTGTAGTTTCGGGCATTGGATGGCTGAT
GGCACCGCTACTTTTCGCTATCATGCCGCGCGGGGCCGGCTACTGGCCCTACGTGTTTCCAGCCATGATCTGCGG
CACCTTGGGCATGGATGTCACATACAATGTCACTAATATCTTCGTTACCGCCTCTCTGCCCCAGCGACAACAGCG
GCTGGCCGCTGCCGTCGCCAATAGCGTTATATTCCTAGGCATCAGTTTCTGGCTGGGGTGGGGTGACTTTACCTC
AGCACAAGTGGATGGAGACTCGCGCGCGAGGTACCAGGCCCCACTCTGGATAGCGGAGGGGTTGGCTGGACTGGG
ACTGATCACCACGGTGCTCTTCGTGAAGATCAAGCCCGCCAAGAGTGAAGTGACTGTAGATGAGAAGGAGGGGAA
CTCGGGAGAAACGGAGGTGCCCAAGGAAGAAATGGACGTTGAGGTGAATGAACAGGCTGCGATTGTCTTGCAATG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail