Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g11696.t1
Gene name
Locationscaffold_346:2748..4143
Strand-
Gene length (bp)1395
Transcript length (bp)1164
Coding sequence length (bp)1164
Protein length (aa) 388

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 110 132 22
2 145 162 17
3 167 189 22
4 204 226 22
5 247 264 17
6 279 301 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g11696.t1
MVKAGRYSTGYGIQLFIRSGKEAYTGGAAGPPKVTITPENGVRTASGSRWPPVDHLLVTVTVDRLPFYSPSLTAV
DRAERRTLLTFLNPTRLYKETPYVIADQRPTDPNILVVEAWGQGFLVGSLVVMIAITAANMKKGMLLHKLIVAEL
ALALGHGTFIFLHAPAYGWYLSVTAVGLTISHSLHNLIAWMKIRGFFPPWGTRLYLITLLAAQPYWVVEIYANFS
FFNRDQTLFTTTRPLEPLFRDPWWIFTTCFLLYIIQRGYGCSLVQLIRISPRFGVMLLFMVISVVFAIVDMCAIR
VENRLGYPPGMEPFWKLAFVFKCLSDTIILDDFKGALDRLGYHYHPDGVPPQEATHARGQSSNRLVDCVPEASLK
PPEPVCRPPDMV*
Coding >Ani_SJS100_1|g11696.t1
ATGGTGAAGGCCGGACGGTACTCTACTGGTTACGGTATCCAACTGTTCATCCGGAGTGGCAAAGAAGCCTACACT
GGAGGCGCGGCTGGACCTCCGAAGGTTACCATTACTCCTGAAAACGGTGTCAGAACAGCAAGCGGCTCTCGCTGG
CCCCCCGTCGATCATTTGCTGGTCACAGTAACAGTCGATCGGCTTCCCTTCTACTCTCCCTCGCTCACGGCAGTT
GACCGTGCCGAGCGGCGAACATTGCTCACGTTCCTCAACCCTACCCGATTATATAAAGAAACCCCATATGTCATT
GCTGACCAGCGTCCTACTGACCCAAATATCCTTGTCGTGGAGGCGTGGGGACAAGGATTCCTGGTGGGCTCCCTT
GTTGTCATGATTGCCATCACCGCGGCCAACATGAAAAAAGGGATGCTTTTGCACAAACTCATCGTGGCAGAGCTC
GCCCTGGCCCTCGGGCACGGAACGTTCATCTTTCTCCATGCGCCTGCGTATGGCTGGTATCTTTCGGTTACGGCT
GTCGGCCTCACAATTTCGCACTCCCTCCACAATTTGATTGCATGGATGAAGATTCGCGGCTTTTTCCCACCCTGG
GGCACGCGACTGTATCTGATCACCCTGCTGGCGGCCCAGCCGTACTGGGTCGTCGAAATCTATGCCAATTTTTCC
TTTTTCAATCGGGACCAGACCTTATTCACCACCACTCGGCCACTTGAGCCGCTGTTCCGGGACCCTTGGTGGATC
TTCACCACCTGCTTTCTCCTGTACATCATCCAGCGTGGTTATGGGTGTTCGCTGGTGCAGCTGATCCGCATCAGC
CCACGGTTCGGCGTCATGCTCTTGTTCATGGTGATCTCCGTTGTATTTGCGATTGTGGACATGTGTGCGATCCGG
GTCGAGAACCGCCTAGGTTACCCCCCGGGGATGGAGCCGTTCTGGAAGTTAGCGTTTGTCTTCAAGTGCCTAAGC
GACACCATCATCTTGGATGATTTCAAAGGCGCCCTGGATCGACTGGGCTATCACTACCACCCGGACGGTGTGCCA
CCGCAGGAGGCCACGCACGCTCGCGGTCAGAGCTCAAACCGGCTTGTGGACTGTGTACCCGAAGCGTCTCTCAAA
CCGCCCGAGCCAGTATGCCGTCCGCCGGACATGGTGTAA
Transcript >Ani_SJS100_1|g11696.t1
ATGGTGAAGGCCGGACGGTACTCTACTGGTTACGGTATCCAACTGTTCATCCGGAGTGGCAAAGAAGCCTACACT
GGAGGCGCGGCTGGACCTCCGAAGGTTACCATTACTCCTGAAAACGGTGTCAGAACAGCAAGCGGCTCTCGCTGG
CCCCCCGTCGATCATTTGCTGGTCACAGTAACAGTCGATCGGCTTCCCTTCTACTCTCCCTCGCTCACGGCAGTT
GACCGTGCCGAGCGGCGAACATTGCTCACGTTCCTCAACCCTACCCGATTATATAAAGAAACCCCATATGTCATT
GCTGACCAGCGTCCTACTGACCCAAATATCCTTGTCGTGGAGGCGTGGGGACAAGGATTCCTGGTGGGCTCCCTT
GTTGTCATGATTGCCATCACCGCGGCCAACATGAAAAAAGGGATGCTTTTGCACAAACTCATCGTGGCAGAGCTC
GCCCTGGCCCTCGGGCACGGAACGTTCATCTTTCTCCATGCGCCTGCGTATGGCTGGTATCTTTCGGTTACGGCT
GTCGGCCTCACAATTTCGCACTCCCTCCACAATTTGATTGCATGGATGAAGATTCGCGGCTTTTTCCCACCCTGG
GGCACGCGACTGTATCTGATCACCCTGCTGGCGGCCCAGCCGTACTGGGTCGTCGAAATCTATGCCAATTTTTCC
TTTTTCAATCGGGACCAGACCTTATTCACCACCACTCGGCCACTTGAGCCGCTGTTCCGGGACCCTTGGTGGATC
TTCACCACCTGCTTTCTCCTGTACATCATCCAGCGTGGTTATGGGTGTTCGCTGGTGCAGCTGATCCGCATCAGC
CCACGGTTCGGCGTCATGCTCTTGTTCATGGTGATCTCCGTTGTATTTGCGATTGTGGACATGTGTGCGATCCGG
GTCGAGAACCGCCTAGGTTACCCCCCGGGGATGGAGCCGTTCTGGAAGTTAGCGTTTGTCTTCAAGTGCCTAAGC
GACACCATCATCTTGGATGATTTCAAAGGCGCCCTGGATCGACTGGGCTATCACTACCACCCGGACGGTGTGCCA
CCGCAGGAGGCCACGCACGCTCGCGGTCAGAGCTCAAACCGGCTTGTGGACTGTGTACCCGAAGCGTCTCTCAAA
CCGCCCGAGCCAGTATGCCGTCCGCCGGACATGGTGTAA
Gene >Ani_SJS100_1|g11696.t1
ATGGTGAAGGCCGGACGGTACTCTACTGGTTACGGTATCCAACTGTTCATCCGGAGTGGCAAAGAAGCCTACACT
GGAGGCGCGGCTGGACCTCCGAAGGTTACCATTACTCCTGAAAACGGTGTCAGAACAGCAAGCGGCTCTCGCTGG
CCCCCCGTCGATCATTTGCTGGTCACAGTAACAGTCGATCGGCTTCCCTTCTACTCTCCCTCGCTCACGGCAGTT
GACCGTGCCGAGCGGCGAACATTGCTCACGTTCCTCAACCCTACCCGATTATATAAAGAAACCCCATATGTCATG
TAATGTCTTTTGCATTCCACCGTTGACACTGAAACCAAAGCGAGAATACGATGCCAAGTGCTGACCAGCGTCCTA
CTGACCCAAATATCCTTGTCGTGGAGGCGTGGGGACAAGGATTCCTGGTGGGCTCCCTTGTTGTCATGATTGCCA
TCACCGCGGCCAACATGAAAAAAGGGATGCTTTTGCACAAACTCATCGTGGCAGAGGTAGGTTGCGCTGTGTCTT
TGGGGCGAATGGGGCACTATCCCCTGCTGATGCGCACGCTTAGCTCGCCCTGGCCCTCGGGCACGGAACGTTCAT
CTTTCTCCATGCGCCTGCGTATGGCTGGTATCTTTCGGTTACGGCTGTCGGCCTCACAATTTCGCACTCCCTCCA
CAATTTGATTGCATGGATGAAGATTCGCGGCTTTTTCCCACCCTGGGGCACGCGACTGTATCTGATCACCCTGCT
GGCGGCCCAGCCGTACTGGGTCGTCGAAATCTATGCCAATTTTTCCTTTTTCAATCGGGACCAGACCTTATTCAC
CACCACTCGGCCACTTGAGCCGCTGTTCCGGTGCGATGTCCGAGTGCGATTCTCCCCTACACCCCGCGTTTTGCT
GATCTATAGCTAGGGACCCTTGGTGGATCTTCACCACCTGCTTTCTCCTGTACATCATCCAGCGTGGTTATGGGT
GTTCGCTGGTGCAGCTGATCCGCATCAGCCCACGGTTCGGCGTCATGCTCTTGTTCATGGTGATCTCCGTTGTAT
TTGCGATTGTGGACATGTGTGCGATCCGGGTCGAGAACCGCCTAGGTTACCCCCCGGGGATGGAGCCGTTCTGGA
AGGTGAGCGGCCGCCACTGACGAGGAGAAGATCAGCATGCTGACCCTGCGGCAGTTAGCGTTTGTCTTCAAGTGC
CTAAGCGACACCATCATCTTGGATGATTTCAAAGGCGCCCTGGATCGACTGGGCTATCACTACCACCCGGACGGT
GTGCCACCGCAGGAGGCCACGCACGCTCGCGGTCAGAGCTCAAACCGGCTTGTGGACTGTGTACCCGAAGCGTCT
CTCAAACCGCCCGAGCCAGTATGCCGTCCGCCGGACATGGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail