Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g11470.t1
Gene name
Locationscaffold_236:4038..8070
Strand+
Gene length (bp)4032
Transcript length (bp)1971
Coding sequence length (bp)1971
Protein length (aa) 657

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04479 RTA1 RTA1 like protein 7.7E-37 449 585

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 417 436 19
2 443 462 19
3 477 499 22
4 520 542 22
5 552 574 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g11470.t1
MHDLKLLLVSGLVLSAEAVASYLYIPPLYHNGSVKVEDLSVAGNLDGPKMRTAANHTSFDFWYFDAFSTSTPAAI
NVVFYNTGDFAANPNPLAVQVSGTFDNGTQFSGQVLASKGVIFDQDDNGIFASWEGTGAAFRGSSLDKSSPEYII
RFDSPGIGVKGDIRLKSRAPPHYPCNPNIAQMNTLLLPHLHWANAIPDATATVDLQINGTDFHITKGVGYHDKNW
GDASVITSPKYWDWGHAQLGPYSIVWYDLLDYNDKEHSYAYVAKNGRVVTVGCADNAVKVRQVGMNATYPPTGGI
PQAQGLTANFDLGGGQVFAVNLTKEVIVHNEVVYARALGSVTGGIVGQETYTGRAMYEEYISVAEAIFKVAGKTW
LLPRPGDLHLAPSMYEYGYGYGYENPLFAMGDYSFYNYNPSLAAAIVALLCYGASTGFHCFQLFKLRCWFFTTFI
AGAIMMTIGYLFRAISTKDTSALGPYVGQNVCILLPPSLYAATIYMIYGRIVMFARSASLSPIAPQKVTKIFVIG
DVIAFLTQASGGGMMAMESMASAGQKLTIFGLFVQLFFFGGFFTISVVFCRRMQQQKNVRMRDVPRGVQAGRETA
RSVNVILPLKEEPQCSRRQIMPKACNNCPDTANMDYPVRQSAVLIVQNTGTVVRCA*
Coding >Ani_SJS100_1|g11470.t1
ATGCATGACCTAAAATTACTCTTGGTTTCGGGGCTTGTTCTTTCCGCAGAGGCCGTGGCCTCCTACCTGTACATT
CCTCCTCTATATCATAATGGGAGCGTCAAAGTGGAAGACCTCTCTGTGGCTGGAAACCTGGATGGACCCAAGATG
AGGACCGCCGCTAATCATACCTCCTTTGACTTTTGGTACTTCGACGCCTTCTCTACATCTACTCCTGCAGCGATC
AATGTCGTGTTCTACAACACAGGAGACTTTGCAGCGAATCCAAATCCTCTTGCTGTTCAAGTATCCGGCACCTTT
GATAACGGCACCCAGTTCTCCGGTCAAGTACTCGCGTCCAAAGGTGTCATATTCGACCAGGACGATAATGGCATC
TTTGCGAGCTGGGAAGGGACTGGTGCAGCCTTCCGTGGATCAAGTCTCGATAAATCGAGTCCTGAATATATCATT
AGGTTTGATTCTCCTGGTATTGGTGTTAAGGGTGACATCCGCCTGAAATCGCGAGCCCCTCCTCACTACCCCTGC
AATCCAAACATCGCGCAAATGAATACCCTCCTCCTCCCGCACCTCCACTGGGCGAACGCCATCCCAGATGCCACC
GCCACTGTAGACCTACAAATCAACGGAACTGACTTCCACATTACTAAAGGAGTCGGCTACCATGACAAGAACTGG
GGTGATGCTTCTGTTATCACCAGCCCAAAATACTGGGACTGGGGCCACGCCCAACTCGGCCCTTACTCGATTGTC
TGGTACGATCTTCTCGATTACAATGACAAGGAGCACTCGTACGCATACGTTGCCAAAAATGGAAGAGTGGTTACA
GTAGGTTGTGCGGATAATGCCGTCAAGGTGCGCCAGGTTGGCATGAATGCCACGTACCCTCCTACCGGGGGTATT
CCTCAAGCACAAGGATTGACGGCCAATTTTGATCTTGGTGGGGGGCAAGTGTTTGCAGTAAATTTGACAAAGGAG
GTTATTGTTCATAACGAAGTCGTGTATGCGCGGGCTTTGGGGTCCGTCACAGGGGGGATTGTTGGCCAGGAGACC
TACACAGGCCGGGCTATGTATGAGGAATATATTTCAGTAGCGGAAGCAATATTCAAAGTTGCCGGTAAAACGTGG
TTGTTACCAAGACCCGGTGATCTGCATCTCGCACCATCAATGTACGAGTACGGCTACGGCTACGGCTACGAGAAC
CCGCTCTTCGCCATGGGTGATTACAGTTTCTACAACTACAACCCGAGCCTCGCGGCAGCCATTGTCGCGCTTCTC
TGCTACGGGGCCAGTACAGGATTCCACTGTTTCCAGCTCTTCAAACTGCGATGCTGGTTTTTCACAACATTCATT
GCCGGAGCCATAATGATGACAATCGGCTACCTCTTCCGCGCGATATCTACCAAGGATACGAGTGCCCTAGGCCCA
TACGTAGGCCAGAACGTGTGCATTCTCCTTCCTCCATCCCTCTACGCAGCCACCATCTACATGATCTACGGCCGC
ATTGTCATGTTCGCCCGCTCTGCCTCCCTCTCCCCTATCGCGCCGCAAAAGGTCACCAAAATATTCGTTATAGGC
GATGTAATTGCTTTCCTGACACAGGCCAGTGGTGGCGGTATGATGGCTATGGAAAGCATGGCTAGTGCGGGTCAG
AAGCTTACGATTTTTGGTCTGTTCGTACAGCTGTTCTTTTTCGGCGGGTTCTTCACTATCTCGGTGGTCTTTTGT
CGTCGAATGCAACAACAGAAGAATGTCCGCATGCGAGACGTTCCTAGGGGCGTTCAGGCTGGCCGCGAGACCGCG
AGGTCCGTCAACGTGATCTTGCCGCTGAAGGAGGAGCCGCAGTGCTCCCGAAGACAGATCATGCCAAAAGCATGC
AATAATTGCCCGGACACCGCGAATATGGACTATCCAGTGCGCCAGAGTGCCGTCCTGATTGTACAGAATACTGGG
ACGGTTGTAAGATGTGCCTAG
Transcript >Ani_SJS100_1|g11470.t1
ATGCATGACCTAAAATTACTCTTGGTTTCGGGGCTTGTTCTTTCCGCAGAGGCCGTGGCCTCCTACCTGTACATT
CCTCCTCTATATCATAATGGGAGCGTCAAAGTGGAAGACCTCTCTGTGGCTGGAAACCTGGATGGACCCAAGATG
AGGACCGCCGCTAATCATACCTCCTTTGACTTTTGGTACTTCGACGCCTTCTCTACATCTACTCCTGCAGCGATC
AATGTCGTGTTCTACAACACAGGAGACTTTGCAGCGAATCCAAATCCTCTTGCTGTTCAAGTATCCGGCACCTTT
GATAACGGCACCCAGTTCTCCGGTCAAGTACTCGCGTCCAAAGGTGTCATATTCGACCAGGACGATAATGGCATC
TTTGCGAGCTGGGAAGGGACTGGTGCAGCCTTCCGTGGATCAAGTCTCGATAAATCGAGTCCTGAATATATCATT
AGGTTTGATTCTCCTGGTATTGGTGTTAAGGGTGACATCCGCCTGAAATCGCGAGCCCCTCCTCACTACCCCTGC
AATCCAAACATCGCGCAAATGAATACCCTCCTCCTCCCGCACCTCCACTGGGCGAACGCCATCCCAGATGCCACC
GCCACTGTAGACCTACAAATCAACGGAACTGACTTCCACATTACTAAAGGAGTCGGCTACCATGACAAGAACTGG
GGTGATGCTTCTGTTATCACCAGCCCAAAATACTGGGACTGGGGCCACGCCCAACTCGGCCCTTACTCGATTGTC
TGGTACGATCTTCTCGATTACAATGACAAGGAGCACTCGTACGCATACGTTGCCAAAAATGGAAGAGTGGTTACA
GTAGGTTGTGCGGATAATGCCGTCAAGGTGCGCCAGGTTGGCATGAATGCCACGTACCCTCCTACCGGGGGTATT
CCTCAAGCACAAGGATTGACGGCCAATTTTGATCTTGGTGGGGGGCAAGTGTTTGCAGTAAATTTGACAAAGGAG
GTTATTGTTCATAACGAAGTCGTGTATGCGCGGGCTTTGGGGTCCGTCACAGGGGGGATTGTTGGCCAGGAGACC
TACACAGGCCGGGCTATGTATGAGGAATATATTTCAGTAGCGGAAGCAATATTCAAAGTTGCCGGTAAAACGTGG
TTGTTACCAAGACCCGGTGATCTGCATCTCGCACCATCAATGTACGAGTACGGCTACGGCTACGGCTACGAGAAC
CCGCTCTTCGCCATGGGTGATTACAGTTTCTACAACTACAACCCGAGCCTCGCGGCAGCCATTGTCGCGCTTCTC
TGCTACGGGGCCAGTACAGGATTCCACTGTTTCCAGCTCTTCAAACTGCGATGCTGGTTTTTCACAACATTCATT
GCCGGAGCCATAATGATGACAATCGGCTACCTCTTCCGCGCGATATCTACCAAGGATACGAGTGCCCTAGGCCCA
TACGTAGGCCAGAACGTGTGCATTCTCCTTCCTCCATCCCTCTACGCAGCCACCATCTACATGATCTACGGCCGC
ATTGTCATGTTCGCCCGCTCTGCCTCCCTCTCCCCTATCGCGCCGCAAAAGGTCACCAAAATATTCGTTATAGGC
GATGTAATTGCTTTCCTGACACAGGCCAGTGGTGGCGGTATGATGGCTATGGAAAGCATGGCTAGTGCGGGTCAG
AAGCTTACGATTTTTGGTCTGTTCGTACAGCTGTTCTTTTTCGGCGGGTTCTTCACTATCTCGGTGGTCTTTTGT
CGTCGAATGCAACAACAGAAGAATGTCCGCATGCGAGACGTTCCTAGGGGCGTTCAGGCTGGCCGCGAGACCGCG
AGGTCCGTCAACGTGATCTTGCCGCTGAAGGAGGAGCCGCAGTGCTCCCGAAGACAGATCATGCCAAAAGCATGC
AATAATTGCCCGGACACCGCGAATATGGACTATCCAGTGCGCCAGAGTGCCGTCCTGATTGTACAGAATACTGGG
ACGGTTGTAAGATGTGCCTAG
Gene >Ani_SJS100_1|g11470.t1
ATGCATGACCTAAAATTACTCTTGGTTTCGGGGCTTGTTCTTTCCGCAGAGGCCGTGGCCTCCTACCTGTACATT
CCTCCTCTATATCATAATGGGAGCGTCAAAGTGGAAGACCTCTCTGTGGCTGGAAACCTGGATGGACCCAAGATG
AGGACCGCCGCTAATCATACCTCCTTTGACTTTTGGTACTTCGACGCCTTCTCTACATCTACTCCTGCAGCGATC
AATGTCGTGTTCTACAACACAGGAGACTTTGCAGCGAATCCAAATCCTCTTGCTGTTCAAGTATCCGGCACCTTT
GATAACGGCACCCAGTTCTCCGGTCAAGTACTCGCGTCCAAAGGTGTCATATTCGACCAGGACGATAATGGCATC
TTTGCGAGCTGGGAAGGGACTGGTGCAGCCTTCCGTGGATCAAGTCTCGATAAATCGAGTCCTGAATATATCATT
AGGTTTGATTCTCCTGGTATTGGTGTTAAGGGTGACATCCGCCTGAAATCGGTATGGTCATTATCCCCCTATCAC
CACCGACAATGTCTTTTTCTCTCATTCTTCCAGGACAAGTACTAATTCATTTCATCTTGTTACGCAGCGAGCCCC
TCCTCACTACCCCTGCAATCCAAACATCGCGCAAATGAATACCCTCCTCCTCCCGCACCTCCACTGGGCGAACGC
CATCCCAGATGCCACCGCCACTGTAGACCTACAAATCAACGGAACTGACTTCCACATTACTAAAGGAGTCGGCTA
CCATGACAAGAACTGGGGTGATGCTTCTGTTATCACCAGCCCAAAATACTGGGACTGGGGCCACGCCCAACTCGG
CCCTTACTCGATTGTCTGGTACGATCTTCTCGATTACAATGACAAGGAGCACTCGTACGCATACGTTGCCAAAAA
TGGAAGAGTGGTTACAGTAGGTTGTGCGGATAATGCCGTCAAGGTGCGCCAGGTTGGCATGAATGCCACGTACCC
TCCTACCGGGGGTATTCCTCAAGCACAAGGATTGACGGCCAATTTTGATCTTGGTGGGGGGCAAGTGTTTGCAGT
AAATTTGACAAAGGAGGTTATTGTTCATAACGAAGTCGTGTATGCGCGGGCTTTGGGGTCCGTCACAGGGGGGAT
TGTTGGCCAGGAGACCTACACAGGCCGGGCTATGTATGAGGAATATATGTATGGGCTTCTGTTTGGCTGAGTTGA
GGGTTTTGGGAGACAGTGGAGCTTAATTGGGGTATAACATCGGTCAGCATCTATCACATGTATCTAGGTTGTTAT
ATAGCTGCAGCTTCGCTGGATAGAGTGATTGGGTAGGAGATACCGATTCTTGGGTCTGATGGGCTGACTCCGTCA
TTATATGTCGTGATAATCGTCATAGATATATGTAGAGGTAACAGTATTGACTTGTTTGGATGGAAGGAGAAGCGT
TGTTTCTGCGTAGCATTAGCATCTTGGTAAACAGATGGTGGCACGACGCACTCCAACGTTGATAGACCATTAATT
ACAGGTGAGGAAACTTACTAGATGATGAAGAAATAGAAACTGGGTGCTGGGTTGAGACAATTAGCATATGTGACA
TCAGGAGTTGGGTATTTTAGGGTGTTTTATTAGAGATCCTTGAATTATTAGTTTCAGTACTAGTCTGCTGAAATT
GTTTTTTTTTTAAAAAAATAAAAAAAAATAAAAGGGGGAATCTCATCGTGGTTAATAAGATGGAAAGGGGTTGAT
CATGAGTACTTCAGATCACGCCGAGCTGTGATCCCAGGGTCCACATACACTGTTCTCACACATTTGCACAAGTTG
TGGCTATGGCGATGCTCTTAGGTGTTTTGACCCACCAATGACCCACCACCCGCACAAGTACGAGTACGTAGACAA
TGCAATTGGTTCAATTCGAATTTTCTGGGCAACTCAATCCTCCTGACCCCCGAACCCCAACTTCTATTCATCTCT
AAACCCTGGTTGGAAAGTTTCAGTTCAGTAGCGGAAGCAATATTCAAAGTTGCCGGTAAAACGTGGTTGTTACCA
AGACCCGGTGATCTGCATCTCGCACCATCAATGTACGAGTACGGCTACGGCTACGGCTACGAGTACATTATGATT
GGCTGGATAGTACTAGCGTGTGAAATCTATCCTGAATTAAGAATGATATCTCCGACAGTAGGAAAAAAAAGCTAG
AGAAATCTAAGCCCACGATTCTGATCGGGTGGGGGGTGATGGCGATTATTTCCAGCGTCCATCAAAAAGCATTAA
TATAAGTATCGCCCACGCAGTATGGCCGGACACTGGACAGGTTAGCATGTCACTAGTCATCTAGGAACCCGCTCT
TCGCCATGGGTGATTACAGTTTCTACAACTACAACCCGAGCCTCGCGGCAGCCATTGTCGCGCTTCTCTGCTACG
GGGCCAGTACAGGATTCCACTGTTTCCAGCTCTTCAAACTGCGATGCTGGTTTTTCACAACATTCATTGCCGGAG
CCATAAGTGAGTCGACTCCCATGTTTTGATCCCAATTTCCATAAAGCTCCACAGGAAGGAACTTACCTCCTACAC
AGTGATGACAATCGGCTACCTCTTCCGCGCGATATCTACCAAGGATACGAGTGCCCTAGGCCCATACGTAGGCCA
GAACGTGTGCATTCTCCTTCCTCCATCCCTCTACGCAGCCACCATCTACATGATCTACGGCCGCATTGTCATGTT
CGCCCGCTCTGCCTCCCTCTCCCCTATCGCGCCGCAAAAGGTCACCAAAATATTCGTTATAGGCGATGTAATTGC
TTTCCTGACACAGGCCAGTGGTGGCGGTATGATGGCTATGGAAAGCATGGCTAGTGCGGGTCAGAAGCTTACGAT
TTTTGGTCTGTTCGTACAGCTGTTCTTTTTCGGCGGGTTCTTCACTATCTCGGTGGTCTTTTGTCGTCGAATGCA
ACAACAGAAGAATGTCCGCATGCGAGACGTTCCGTATGGTGCGTTGCTTTACGTTTTATTTGGGGTCTCGGGGCT
CATCATCGTTCGGTGTCTATATCGCGTTGTGGAGTTTTGTCAGGGAAATGATGGCTATTTGATAAGTCATGAGGT
TTTCATGTATTTGTTCGACACATTGTTGATGTTCGTGGTACAGGTTGTTTTTCATTTTTATCACCCTGGACTGCT
TCTTGGGGACGGGAAGTATGGTGGGTTGGAGATGGAAGGATAGTAGTACTCAAGATTTGGAAATTACAGCCATGG
CGAAGGAGACAGATATTAGAATCCGTTTCTTCAGCCTACAGTTAATACATTCTTGGAAAGTCTAAGTTCCAGTCT
ACGAGCAATAATGCTGTGCAGATTCTGAGAAATCGGATGTTGCTGATTTGTATACCCACAATGATTTAAAGAAAC
TTGAAATGATATCATACAATGAGACGTGGTCCAGATATATCTACCCAGTACAGTTCCATATATCTGTGGTCTGAC
ATAAGAGAGAAGTATTTGAGAGAGAGTCGCGTTTCAGTCCTGCCCATCCGTGCACAGTCCCAATCCATCCATTGG
CCAATGTAAACAGCTTCGCCAAGATGAGTCCAGCGAACCATATATTTCCCGTATCATCTTCTCCGGCCATGTCCC
AATCCAATATGCTGGCTCACTTGACTTCAGCAGGACGCATGCATGGGCGAAGATAACAAGAGCAAATGGATCCCG
GCCACCCAATAAAGTCGCAAATTCGTTGTCACAATGTGACAGCCAACCGAAGAACGCCGATCCACCCATTTTAGA
CCAGCTGAGTAACTTACTCACCGCTTGTAGTAGGGTATGGACACTGTTCATGGTTACTGTGCTCCGCCGTATTTG
GTCGGCTAGGGCGTTCAGGCTGGCCGCGAGACCGCGAGGTCCGTCAACGTGATCTTGCCGCTGAAGGAGGAGCCG
CAGTGCTCCCGAAGACAGATCATGCCAAAAGCATGCAATAATTGCCCGGACACCGCGAATATGGACTATCCAGTG
CGCCAGAGTGCCGTCCTGATTGTACAGAATACTGGGACGGTTGTAAGATGTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail