Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g11467.t1
Gene name
Locationscaffold_234:9952..11791
Strand-
Gene length (bp)1839
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.8E-13 76 466

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 122 141 19
2 146 168 22
3 181 203 22
4 208 230 22
5 265 284 19
6 288 305 17
7 318 337 19
8 357 379 22
9 388 407 19
10 412 434 22
11 447 469 22
12 530 547 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g11467.t1
MGFLNREKTAETVNVNMATLEAQADSNRQSLEQKNEKEVQEHPDEVTGDARAGVQKAEATALVWTKKTLYSTYAC
TNMIYYAHANLASAPQISQAYVVSTIVGGVLQLPIAKILNVWGRTEGVLVFLTIDLVGVFVIASCNGPNGFAAGY
TLWYIGYSSLKFILSVFVADASGLKNRAFVYAFIGTRTICTTFSGSIIAQAFPGHLTWRWSYGCFTIITVVIFLP
LAIVFKFYPRKAVKLGLLTPLASHRTIPQSNIHYIHEFDLVGGALLMAAFILFLLPFSLQTYGYSGYSGYSSMTF
IAVLLRPRQLHQVELLRTRTVLGACVLSAIIFFNYNTSDQYSYYYIQVMYDLDTSKAWYMTQIYGVGSTIWAVLF
GVWIRTTKYFKHGSLFFGAPLLLLGAALMIHFHGAQSHIGFLVMCQIFIAVGGGTLVLGDEMAVMAATDRDGVPL
MIAMISLSGSVGGALGYAVASAIHTNTFPEALLRALPDTAKADYATIYSGGSAVQLTYPPGSAERDAINYAWAYS
QKYECITAACLVVLAFPAIAVWKNHNLDKKQVKGIVI*
Coding >Ani_SJS100_1|g11467.t1
ATGGGTTTCCTCAATCGAGAAAAGACCGCGGAGACAGTCAACGTGAACATGGCCACACTCGAGGCCCAGGCAGAT
TCAAACCGACAGAGCCTGGAGCAGAAGAATGAGAAAGAAGTGCAGGAGCATCCCGATGAAGTCACCGGGGACGCA
CGAGCAGGAGTGCAGAAGGCCGAAGCAACAGCTCTCGTGTGGACCAAAAAGACCCTGTATAGCACATACGCATGC
ACTAATATGATCTACTACGCCCACGCCAATCTCGCCTCCGCACCGCAGATCTCGCAGGCGTATGTCGTGTCAACC
ATCGTGGGCGGTGTTCTGCAACTTCCGATTGCCAAGATACTCAACGTATGGGGTCGCACGGAGGGAGTTCTGGTC
TTCCTGACCATCGACCTGGTTGGAGTGTTTGTCATCGCCTCCTGTAATGGACCCAACGGTTTCGCGGCTGGCTAC
ACACTCTGGTATATCGGCTATTCATCGCTGAAATTCATCCTCTCCGTTTTCGTCGCCGATGCCTCAGGGCTGAAG
AACCGCGCCTTTGTGTATGCCTTCATCGGCACCCGGACCATCTGCACGACGTTTTCGGGCTCCATCATCGCCCAG
GCGTTCCCCGGGCACTTGACCTGGCGCTGGTCGTATGGCTGCTTTACTATTATCACCGTCGTGATCTTCTTGCCT
CTCGCGATAGTCTTCAAGTTCTACCCACGCAAAGCCGTGAAGCTCGGACTTCTTACGCCCCTCGCCAGCCACCGC
ACCATCCCGCAATCCAATATCCACTACATCCACGAATTCGACCTCGTGGGTGGCGCCCTGCTGATGGCCGCCTTC
ATCCTCTTCCTCCTGCCTTTCAGCCTGCAAACGTACGGCTACTCCGGCTACTCCGGCTACTCCTCCATGACGTTC
ATCGCCGTCCTACTGCGCCCGCGTCAACTTCATCAAGTGGAACTCTTGCGCACGCGCACCGTACTGGGAGCCTGC
GTACTCTCAGCCATCATCTTCTTCAACTACAACACCTCGGACCAGTACTCCTACTACTACATCCAGGTCATGTAC
GACCTCGACACCTCCAAGGCCTGGTACATGACGCAGATCTACGGCGTCGGCTCGACGATTTGGGCGGTGTTGTTC
GGCGTCTGGATCCGCACGACGAAGTACTTCAAGCACGGGAGCCTCTTCTTCGGCGCACCCTTACTGCTCCTGGGC
GCCGCGCTGATGATCCACTTCCACGGCGCGCAATCCCACATCGGGTTCCTGGTGATGTGTCAGATCTTCATCGCC
GTGGGCGGTGGCACGCTGGTTCTTGGGGATGAGATGGCCGTGATGGCCGCCACTGACCGCGACGGCGTGCCGCTG
ATGATCGCCATGATCAGTCTGAGTGGGAGTGTGGGTGGTGCCTTGGGCTACGCCGTCGCCAGCGCCATCCACACG
AATACCTTTCCCGAAGCGCTGCTCCGTGCCCTGCCGGATACGGCCAAGGCGGATTACGCGACGATCTATAGCGGA
GGCTCGGCGGTGCAGCTGACCTACCCGCCAGGCAGTGCGGAGAGAGACGCTATCAATTACGCCTGGGCCTATAGC
CAGAAGTATGAGTGTATCACTGCTGCTTGTCTGGTGGTGCTGGCTTTCCCGGCCATTGCGGTGTGGAAGAATCAT
AACCTGGATAAGAAACAGGTCAAGGGGATTGTTATCTAG
Transcript >Ani_SJS100_1|g11467.t1
ATGGGTTTCCTCAATCGAGAAAAGACCGCGGAGACAGTCAACGTGAACATGGCCACACTCGAGGCCCAGGCAGAT
TCAAACCGACAGAGCCTGGAGCAGAAGAATGAGAAAGAAGTGCAGGAGCATCCCGATGAAGTCACCGGGGACGCA
CGAGCAGGAGTGCAGAAGGCCGAAGCAACAGCTCTCGTGTGGACCAAAAAGACCCTGTATAGCACATACGCATGC
ACTAATATGATCTACTACGCCCACGCCAATCTCGCCTCCGCACCGCAGATCTCGCAGGCGTATGTCGTGTCAACC
ATCGTGGGCGGTGTTCTGCAACTTCCGATTGCCAAGATACTCAACGTATGGGGTCGCACGGAGGGAGTTCTGGTC
TTCCTGACCATCGACCTGGTTGGAGTGTTTGTCATCGCCTCCTGTAATGGACCCAACGGTTTCGCGGCTGGCTAC
ACACTCTGGTATATCGGCTATTCATCGCTGAAATTCATCCTCTCCGTTTTCGTCGCCGATGCCTCAGGGCTGAAG
AACCGCGCCTTTGTGTATGCCTTCATCGGCACCCGGACCATCTGCACGACGTTTTCGGGCTCCATCATCGCCCAG
GCGTTCCCCGGGCACTTGACCTGGCGCTGGTCGTATGGCTGCTTTACTATTATCACCGTCGTGATCTTCTTGCCT
CTCGCGATAGTCTTCAAGTTCTACCCACGCAAAGCCGTGAAGCTCGGACTTCTTACGCCCCTCGCCAGCCACCGC
ACCATCCCGCAATCCAATATCCACTACATCCACGAATTCGACCTCGTGGGTGGCGCCCTGCTGATGGCCGCCTTC
ATCCTCTTCCTCCTGCCTTTCAGCCTGCAAACGTACGGCTACTCCGGCTACTCCGGCTACTCCTCCATGACGTTC
ATCGCCGTCCTACTGCGCCCGCGTCAACTTCATCAAGTGGAACTCTTGCGCACGCGCACCGTACTGGGAGCCTGC
GTACTCTCAGCCATCATCTTCTTCAACTACAACACCTCGGACCAGTACTCCTACTACTACATCCAGGTCATGTAC
GACCTCGACACCTCCAAGGCCTGGTACATGACGCAGATCTACGGCGTCGGCTCGACGATTTGGGCGGTGTTGTTC
GGCGTCTGGATCCGCACGACGAAGTACTTCAAGCACGGGAGCCTCTTCTTCGGCGCACCCTTACTGCTCCTGGGC
GCCGCGCTGATGATCCACTTCCACGGCGCGCAATCCCACATCGGGTTCCTGGTGATGTGTCAGATCTTCATCGCC
GTGGGCGGTGGCACGCTGGTTCTTGGGGATGAGATGGCCGTGATGGCCGCCACTGACCGCGACGGCGTGCCGCTG
ATGATCGCCATGATCAGTCTGAGTGGGAGTGTGGGTGGTGCCTTGGGCTACGCCGTCGCCAGCGCCATCCACACG
AATACCTTTCCCGAAGCGCTGCTCCGTGCCCTGCCGGATACGGCCAAGGCGGATTACGCGACGATCTATAGCGGA
GGCTCGGCGGTGCAGCTGACCTACCCGCCAGGCAGTGCGGAGAGAGACGCTATCAATTACGCCTGGGCCTATAGC
CAGAAGTATGAGTGTATCACTGCTGCTTGTCTGGTGGTGCTGGCTTTCCCGGCCATTGCGGTGTGGAAGAATCAT
AACCTGGATAAGAAACAGGTCAAGGGGATTGTTATCTAG
Gene >Ani_SJS100_1|g11467.t1
ATGGGTTTCCTCAATCGAGAAAAGACCGCGGAGACAGTCAACGTGAACATGGCCACACTCGAGGCCCAGGCAGAT
TCAAACCGACAGAGCCTGGAGCAGAAGAATGAGAAAGAAGTGCAGGAGCATCCCGATGAAGTCACCGGGGACGCA
CGAGCAGGAGTGCAGAAGGCCGAAGCAACAGCTCTCGTGTGGACCAAAAAGACCCTGTATAGCACATACGCATGG
TAAATTCCCCAAGACCGTCTATCATATACCCTCCATTGACAGAAGCCCCTTTTGCAGGATCTGATTGTGCTTCTT
CGTCTTGTCGATGTAATCGTCGATCAGCACTAATATGATCTACTACGCCCACGCCAATCTCGCCTCCGCACCGCA
GATCTCGCAGGCGTATGTCGTGTCAACCATCGTGGGCGGTGTTCTGCAACTTCCGATTGCCAAGATACTCAACGT
ATGGGGTCGCACGGAGGGAGTTCTGGTCTTCCTGACCATCGACCTGGTTGGAGTGTTTGTCATCGCCTCCTGTAA
TGGACCCAACGGTTTCGCGGCTGGCTACACACTCTGGTATATCGGCTATTCATCGCTGAAATTCATCCTCTCCGT
TTTCGTCGCCGATGCCTCAGGGCTGAAGAACCGCGCCTTTGTGTATGCCTTCATCGGCACCCGGACCATCTGCAC
GACGTTTTCGGGCTCCATCATCGCCCAGGCGTTCCCCGGGCACTTGACCTGGCGCTGGTCGTATGGCTGCTTTAC
TATTATCACCGTCGTGATCTTCTTGCCTCTCGCGATAGTCTTCAAGTTCTACCCACGCAAAGCCGTGAAGCTCGG
ACTTCTTACGCCCCTCGCCAGCCACCGCACCATCCCGCAATCCAATATCCACTACATCCACGAATTCGACCTCGT
GGGTGGCGCCCTGCTGATGGCCGCCTTCATCCTCTTCCTCCTGCCTTTCAGCCTGCAAACGTACGGCTACTCCGG
CTACTCCGGCTACTCCTCCATGACGTTCATCGCCGTGTTGGTCGTTGGCCTGCTCCTCTTCCCGGTCTTCGCGCT
CTGGGAAGCCTACTGCGCCCGCGTCAACTTCATCAAGTGGAACTCTTGCGCACGCGCACCGTACTGGGAGCCTGC
GTACTCTCAGCCATCATCTTCTTCAACTACAACACCTCGGACCAGTACTCCTACTACTACATCCAGGTCATGTAC
GACCTCGACACCTCCAAGGCCTGGTACATGACGCAGATCTACGGCGTCGGCTCGACGATTTGGGCGGTGTTGTTC
GGCGTCTGGATCCGCACGACGAAGTACTTCAAGCACGGGAGCCTCTTCTTCGGCGCACCCTTACTGCTCCTGGGC
GCCGCGCTGATGATCCACTTCCACGGCGCGCAATCCCACATCGGGTTCCTGGTGATGTGTCAGATCTTCATCGCC
GTGGGCGGTGGCACGCTGGTTCTTGGGGATGAGATGGCCGTGATGGCCGCCACTGACCGCGACGGCGTGCCGCTG
ATGATCGCCATGATCAGTCTGAGTGGGAGTGTGGGTGGTGCCTTGGGCTACGCCGTCGCCAGCGCCATCCACACG
AATACCTTTCCCGAAGCGCTGCTCCGTGCCCTGCCGGATACGGCCAAGGCGGATTACGCGACGATCTATAGCGGA
GGCTCGGCGGTGCAGCTGACCTACCCGCCAGGCAGTGCGGAGAGAGACGCTATCAATTACGCCTGGGCCTATAGC
CAGAAGTATGAGTGTATCACTGCTGCTTGTCTGGTGGTGCTGGCTTTCCCGGCCATTGCGGTGTGGAAGAATCAT
AACCTGGATAAGAAACAGGTCAAGGGGATTGTTATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail