Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g11449.t1
Gene name
Locationscaffold_227:12151..13055
Strand-
Gene length (bp)904
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 5.1E-22 34 140

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g11449.t1
MRRLVYLLALAGLTTKSLGQQKQQQQPLSATAKPNVVFILTDDQDAHLGSLDYMPYVQKHLLDKGTHYRSHYCTT
SVCCPSRVTLWTGKLAHNTNVTDVNPPHGGYPKIISQGLNDNYLPVWLQEAGYNTYYTGKLFNVHTVDITVADVI
NAIDYAIPAIEIIDSRVKNWAIDLPDTLADNGSTGAIILGGTPRKLTELTLNDTRGVLKHNGKELMTGNTKNVLG
NPISAVAWLVNRLAEYDIEFLAGQVIMPGSCLEAIPMEVGQWTCTFEGWGTIEFDVV*
Coding >Ani_SJS100_1|g11449.t1
ATGCGACGCCTGGTGTATTTATTAGCCCTGGCGGGGCTTACTACAAAGTCGCTAGGGCAGCAGAAGCAGCAGCAG
CAGCCGCTTTCTGCGACCGCCAAGCCCAATGTCGTCTTCATATTAACCGATGATCAAGACGCCCATCTCGGCTCT
TTGGATTACATGCCTTATGTACAAAAGCACCTCCTAGACAAAGGAACACACTATCGCAGTCACTACTGTACAACC
AGTGTCTGTTGTCCATCGCGTGTGACCCTTTGGACGGGAAAGCTGGCCCATAATACGAACGTCACGGATGTCAAT
CCTCCGCATGGCGGCTATCCAAAAATTATCTCTCAAGGTCTAAATGACAATTATCTCCCTGTTTGGCTGCAGGAA
GCGGGGTACAACACTTACTACACTGGTAAACTGTTCAACGTTCACACGGTCGACATCACCGTAGCGGATGTCATC
AATGCCATTGACTATGCTATTCCCGCTATTGAAATCATCGATTCTCGCGTGAAGAACTGGGCTATTGATCTGCCC
GATACGCTTGCGGATAACGGGTCAACTGGAGCTATTATACTCGGTGGAACGCCGCGCAAGCTTACTGAGCTTACA
CTTAATGATACCCGTGGTGTCTTGAAACATAATGGCAAGGAGTTGATGACTGGGAATACGAAGAATGTTCTTGGG
AACCCGATATCGGCTGTGGCGTGGTTGGTGAACCGGTTGGCGGAATACGATATTGAATTTCTGGCAGGGCAGGTT
ATTATGCCGGGAAGTTGTCTGGAGGCTATTCCTATGGAAGTTGGTCAGTGGACTTGTACGTTTGAGGGGTGGGGG
ACTATTGAGTTCGATGTTGTGTAA
Transcript >Ani_SJS100_1|g11449.t1
ATGCGACGCCTGGTGTATTTATTAGCCCTGGCGGGGCTTACTACAAAGTCGCTAGGGCAGCAGAAGCAGCAGCAG
CAGCCGCTTTCTGCGACCGCCAAGCCCAATGTCGTCTTCATATTAACCGATGATCAAGACGCCCATCTCGGCTCT
TTGGATTACATGCCTTATGTACAAAAGCACCTCCTAGACAAAGGAACACACTATCGCAGTCACTACTGTACAACC
AGTGTCTGTTGTCCATCGCGTGTGACCCTTTGGACGGGAAAGCTGGCCCATAATACGAACGTCACGGATGTCAAT
CCTCCGCATGGCGGCTATCCAAAAATTATCTCTCAAGGTCTAAATGACAATTATCTCCCTGTTTGGCTGCAGGAA
GCGGGGTACAACACTTACTACACTGGTAAACTGTTCAACGTTCACACGGTCGACATCACCGTAGCGGATGTCATC
AATGCCATTGACTATGCTATTCCCGCTATTGAAATCATCGATTCTCGCGTGAAGAACTGGGCTATTGATCTGCCC
GATACGCTTGCGGATAACGGGTCAACTGGAGCTATTATACTCGGTGGAACGCCGCGCAAGCTTACTGAGCTTACA
CTTAATGATACCCGTGGTGTCTTGAAACATAATGGCAAGGAGTTGATGACTGGGAATACGAAGAATGTTCTTGGG
AACCCGATATCGGCTGTGGCGTGGTTGGTGAACCGGTTGGCGGAATACGATATTGAATTTCTGGCAGGGCAGGTT
ATTATGCCGGGAAGTTGTCTGGAGGCTATTCCTATGGAAGTTGGTCAGTGGACTTGTACGTTTGAGGGGTGGGGG
ACTATTGAGTTCGATGTTGTGTAA
Gene >Ani_SJS100_1|g11449.t1
ATGCGACGCCTGGTGTATTTATTAGCCCTGGCGGGGCTTACTACAAAGTCGCTAGGGCAGCAGAAGCAGCAGCAG
CAGCCGCTTTCTGCGACCGCCAAGCCCAATGTCGTCTTCATATTAACCGATGATCAAGACGCCCATCTCGGCTCT
TTGGATTACATGCCTTATGTACAAAAGCACCTCCTAGACAAAGGAACACACTATCGCAGTCACTACTGTACAACC
AGTGTCTGTTGTCCATCGCGTGTGACCCTTTGGACGGGAAAGCTGGCCCATAATACGAACGTCACGGATGTCAAT
CCTCCGCATGGTGAGTGTACTACACATCGCCACTTATATCGGGGGATATTCTCATACGCTTTCAGGCGGCTATCC
AAAAATTATCTCTCAAGGTCTAAATGACAATTATCTCCCTGTTTGGCTGCAGGAAGCGGGGTACAACACTTACTA
CACTGGTAAACTGTTCAACGTTCACACGGTCGACATCACCGTAGCGGATGTCATCAATGCCATTGACTATGCTAT
TCCCGCTATTGAAATCATCGATTCTCGCGTGAAGAACTGGGCTATTGATCTGCCCGATACGCTTGCGGATAACGG
GTCAACTGGAGCTATTATACTCGGTGGAACGCCGCGCAAGCTTACTGAGCTTACACTTAATGATACCCGTGGTGT
CTTGAAACATAATGGCAAGGAGTTGATGACTGGGAATACGAAGAATGTTCTTGGGAACCCGATATCGGCTGTGGC
GTGGTTGGTGAACCGGTTGGCGGAATACGATATTGAATTTCTGGCAGGGCAGGTTATTATGCCGGGAAGTTGTCT
GGAGGCTATTCCTATGGAAGTTGGTCAGTGGACTTGTACGTTTGAGGGGTGGGGGACTATTGAGTTCGATGTTGT
GTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail