Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g11363.t1
Gene name
Locationscaffold_200:9310..10831
Strand+
Gene length (bp)1521
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 1.1E-14 252 391

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0008168 methyltransferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g11363.t1
MSTNKAAEGAKRNPCPVDISIAARPNNIKDVPIMLKSIEDGVKTIATNSEEHRKDLLVRCRALVQALETPRETMV
NHCWGQIGAMSAISFGVECGLWVLMAQNGDESQKVADLAMSLGVDPELLRRPMRHMGAMGLLLEVGEDEYKPTNY
TRALSLPQIGHGYLGLAATLRFHEFSRKTGWRNPTDHLSTSLMCAYGTNKDVFSWVHDMGYGRHLNDYLGGYSLG
RTLWMDTDVYPVQQRLIEGADTRPDAPFLVDIGGNVGHDLERFHNRYPNAPGKLILQDLPIMIEQIDVLHPAIVR
MKYDFHQEQPIKGARAYYIHSTLHNWPDSVCDSILANVKAAMKQGYSKLLINENVLPVTGAHWETTGLDMMMLTL
FSSQERTEKMWYDLIENRASLKIVKIWSGGKGVESVIECELP*
Coding >Ani_SJS100_1|g11363.t1
ATGTCCACTAACAAGGCAGCCGAGGGCGCAAAGCGCAACCCATGTCCGGTCGATATCTCTATTGCCGCACGCCCG
AACAATATCAAGGACGTGCCAATAATGTTGAAAAGTATCGAGGATGGCGTCAAAACTATTGCTACGAACTCTGAG
GAGCATCGCAAAGACCTGCTTGTTAGGTGCCGAGCTTTAGTTCAAGCTCTAGAGACTCCGCGGGAGACGATGGTC
AACCACTGCTGGGGCCAGATCGGCGCAATGTCGGCTATAAGCTTTGGTGTGGAATGCGGACTCTGGGTGTTGATG
GCCCAGAACGGTGACGAATCCCAGAAGGTGGCTGACTTGGCTATGAGCCTTGGTGTTGATCCCGAGCTTTTGCGG
CGTCCGATGCGGCATATGGGTGCTATGGGCCTTCTTCTCGAGGTTGGTGAAGATGAGTACAAGCCCACAAACTAT
ACTAGAGCTCTGAGTCTTCCCCAGATCGGTCATGGGTATCTTGGTCTTGCAGCCACCTTGCGATTCCACGAGTTC
TCTCGCAAGACTGGCTGGAGGAACCCTACTGACCATCTGAGCACAAGCCTGATGTGTGCCTATGGTACGAACAAG
GATGTTTTCTCCTGGGTGCACGATATGGGCTATGGAAGACACCTGAATGACTACCTTGGCGGCTATAGCCTGGGT
CGCACGCTTTGGATGGACACTGATGTCTACCCTGTGCAGCAAAGACTCATTGAAGGCGCTGATACTCGTCCAGAT
GCACCTTTTCTTGTGGACATAGGAGGTAATGTGGGCCATGACTTGGAGAGGTTCCATAATCGCTATCCGAATGCT
CCGGGCAAATTAATTCTTCAGGATCTGCCAATAATGATAGAACAAATTGATGTTCTTCACCCGGCTATTGTCCGC
ATGAAGTATGATTTCCATCAGGAACAGCCTATTAAGGGTGCGCGAGCCTATTATATACACTCCACTCTGCATAAT
TGGCCGGACTCTGTATGTGACAGTATCCTTGCGAATGTCAAGGCAGCCATGAAGCAGGGGTATAGCAAGCTACTA
ATCAACGAAAACGTTCTGCCCGTGACTGGCGCACACTGGGAGACGACAGGACTCGACATGATGATGTTAACCTTG
TTCTCTAGCCAGGAGAGGACAGAAAAGATGTGGTACGACCTGATTGAGAACAGGGCAAGCTTGAAAATTGTCAAG
ATTTGGAGTGGTGGGAAGGGGGTGGAAAGTGTAATTGAGTGCGAGCTACCTTGA
Transcript >Ani_SJS100_1|g11363.t1
ATGTCCACTAACAAGGCAGCCGAGGGCGCAAAGCGCAACCCATGTCCGGTCGATATCTCTATTGCCGCACGCCCG
AACAATATCAAGGACGTGCCAATAATGTTGAAAAGTATCGAGGATGGCGTCAAAACTATTGCTACGAACTCTGAG
GAGCATCGCAAAGACCTGCTTGTTAGGTGCCGAGCTTTAGTTCAAGCTCTAGAGACTCCGCGGGAGACGATGGTC
AACCACTGCTGGGGCCAGATCGGCGCAATGTCGGCTATAAGCTTTGGTGTGGAATGCGGACTCTGGGTGTTGATG
GCCCAGAACGGTGACGAATCCCAGAAGGTGGCTGACTTGGCTATGAGCCTTGGTGTTGATCCCGAGCTTTTGCGG
CGTCCGATGCGGCATATGGGTGCTATGGGCCTTCTTCTCGAGGTTGGTGAAGATGAGTACAAGCCCACAAACTAT
ACTAGAGCTCTGAGTCTTCCCCAGATCGGTCATGGGTATCTTGGTCTTGCAGCCACCTTGCGATTCCACGAGTTC
TCTCGCAAGACTGGCTGGAGGAACCCTACTGACCATCTGAGCACAAGCCTGATGTGTGCCTATGGTACGAACAAG
GATGTTTTCTCCTGGGTGCACGATATGGGCTATGGAAGACACCTGAATGACTACCTTGGCGGCTATAGCCTGGGT
CGCACGCTTTGGATGGACACTGATGTCTACCCTGTGCAGCAAAGACTCATTGAAGGCGCTGATACTCGTCCAGAT
GCACCTTTTCTTGTGGACATAGGAGGTAATGTGGGCCATGACTTGGAGAGGTTCCATAATCGCTATCCGAATGCT
CCGGGCAAATTAATTCTTCAGGATCTGCCAATAATGATAGAACAAATTGATGTTCTTCACCCGGCTATTGTCCGC
ATGAAGTATGATTTCCATCAGGAACAGCCTATTAAGGGTGCGCGAGCCTATTATATACACTCCACTCTGCATAAT
TGGCCGGACTCTGTATGTGACAGTATCCTTGCGAATGTCAAGGCAGCCATGAAGCAGGGGTATAGCAAGCTACTA
ATCAACGAAAACGTTCTGCCCGTGACTGGCGCACACTGGGAGACGACAGGACTCGACATGATGATGTTAACCTTG
TTCTCTAGCCAGGAGAGGACAGAAAAGATGTGGTACGACCTGATTGAGAACAGGGCAAGCTTGAAAATTGTCAAG
ATTTGGAGTGGTGGGAAGGGGGTGGAAAGTGTAATTGAGTGCGAGCTACCTTGA
Gene >Ani_SJS100_1|g11363.t1
ATGTCCACTAACAAGGCAGCCGAGGGCGCAAAGCGCAACCCATGTCCGGTCGATATCTCTATTGCCGCACGCCCG
AACAATATCAAGGACGTGCCAATAATGTTGAAAAGTATCGAGGATGGCGTCAAAACTATTGCTACGAACTCTGAG
GAGCATCGCAAAGACCTGCTTGTTAGGTGCCGAGCTTTAGTTCAAGCTCTAGAGACTCCGCGGGAGACGATGGTC
AACCACTGCTGGGGCCAGGTAAATGACAACAAAACCCAGGGGTTCGACATAGTAAACTGACACGATAGATCGGCG
CAATGTCGGCTATAAGCTTTGGTGTGGAATGCGGACTCTGGGTGTTGATGGCCCAGAACGGTGACGAATCCCAGA
AGGTGGCTGACTTGGCTATGAGCCTTGGTGTTGATCCCGAGCTTTTGCGTAAGCACCAGTTCAATCTCATCACAA
AGTTTCAGCTAATGACTGGCTAGGGCGTCCGATGCGGCATATGGGTGCTATGGGCCTTCTTCTCGAGGTTGGTGA
AGATGAGTACAAGCCCACAAACTATACTAGAGCTCTGAGTCTTCCCCAGATCGGTCATGGGTATCTTGGTCTGTA
AGTGCATGTTCAGCAGGTATTTCAGCCTTATTTATCTACGAAATCGTGACTCATTTCTCTTGTCGTGAACCAGTA
CTGCGTGCACCAGTGCAGCCACCTTGCGATTCCACGAGTTCTCTCGCAAGACTGGCTGGAGGAACCCTACTGACC
ATCTGAGCACAAGCCTGATGTGTGCCTATGGTACGAACAAGGATGTTTTCTCCTGGGTGCACGATATGGGCTATG
GAAGACACCTGAATGACTACCTTGGCGGCTATAGCCTGGGTCGCACGCTTTGGATGGACACTGATGTCTACCCTG
TGCAGCAAAGACTCATTGAAGGCGCTGATACTCGTCCAGATGCACCTTTTCTTGTGGACATAGGAGGTAATGTGG
GCCATGACTTGGAGAGGTTCCATAATCGCTATCCGAATGCTCCGGGCAAATTAATTCTTCAGGATCTGCCAATAA
TGATAGAACAAATTGATGTTCTTCACCCGGCTATTGTCCGCATGAAGTATGATTTCCATCAGGAACAGCCTATTA
AGGGTAAGAGTTGCAGCCCCCTCAGGCAAGATTGACTCTCATCCCTCGAATTATGATGATTGACTTGCCTTACGC
CTAGGTGCGCGAGCCTATTATATACACTCCACTCTGCATAATTGGCCGGACTCTGTATGTGACAGTATCCTTGCG
AATGTCAAGGCAGCCATGAAGCAGGGGTATAGCAAGCTACTAATCAACGAAAACGTTCTGCCCGTGACTGGCGCA
CACTGGGAGACGACAGGACTCGACATGATGATGTTAACCTTGTTCTCTAGCCAGGAGAGGACAGAAAAGATGTGG
TACGACCTGATTGAGAACAGGGCAAGCTTGAAAATTGTCAAGATTTGGAGTGGTGGGAAGGGGGTGGAAAGTGTA
ATTGAGTGCGAGCTACCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail