Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g11324.t1
Gene name
Locationscaffold_189:585..1416
Strand+
Gene length (bp)831
Transcript length (bp)831
Coding sequence length (bp)831
Protein length (aa) 277

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.3E-14 106 255

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 132 154 22
2 167 189 22
3 194 216 22
4 223 245 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g11324.t1
MTSKSAGLSAAEPIFPQIPRVALVPQDDASSPLSSLELHSIEPIGANTPHSRRTRHAGSTKPSEVDEMFNVVQSA
AAENYGTQDTNRKTASIHPRRNTIWRLASACLMNFGNGMNDSAPGALIPYIEDDYGIGYAIISLIFIANAVGFVL
AAPLTHTIQARIGHAKSYALSMSLVTAGYVAIVCHPPFPVVVTAFLLLGFGMALSIALNNVFCANLNSYATALGF
FSGAYGIGGVISPLLATAMVSHGIRWTYLLLHHTGDFDVEYVACGCRLSQL*
Coding >Ani_SJS100_1|g11324.t1
ATGACCAGCAAGTCTGCCGGGCTCTCCGCAGCCGAACCGATATTTCCACAAATTCCACGTGTCGCCCTAGTCCCG
CAAGACGATGCCTCGTCCCCATTGTCAAGTCTGGAGTTGCATTCCATTGAACCGATAGGGGCCAATACGCCGCAT
AGTAGGCGCACAAGGCATGCCGGGTCAACAAAACCCTCCGAAGTCGACGAGATGTTCAACGTCGTGCAGTCAGCA
GCAGCAGAGAACTATGGAACTCAAGACACAAATAGGAAAACAGCCTCGATACACCCGCGCAGGAACACGATCTGG
CGACTAGCTAGCGCGTGCCTGATGAACTTTGGCAACGGAATGAACGACAGTGCACCCGGTGCCCTAATCCCTTAT
ATTGAGGATGATTACGGGATTGGCTACGCCATCATCTCACTGATCTTCATCGCCAACGCCGTCGGATTCGTTCTT
GCCGCGCCCCTTACTCACACAATCCAAGCCCGAATCGGCCACGCCAAAAGCTATGCTCTCTCGATGAGTCTCGTC
ACAGCGGGCTACGTTGCCATCGTATGCCACCCGCCCTTTCCGGTCGTTGTCACGGCGTTTCTCCTCCTCGGCTTC
GGGATGGCGTTAAGCATCGCGCTTAACAATGTCTTCTGCGCAAACCTAAACAGCTATGCCACAGCACTGGGCTTT
TTCTCCGGTGCGTATGGCATCGGTGGGGTGATCTCCCCACTATTGGCCACGGCCATGGTGTCACACGGCATCCGC
TGGACATACCTTCTACTTCATCACACTGGTGATTTCGACGTTGAATATGTTGCTTGCGGCTGTCGTCTTTCGCAA
TTATAA
Transcript >Ani_SJS100_1|g11324.t1
ATGACCAGCAAGTCTGCCGGGCTCTCCGCAGCCGAACCGATATTTCCACAAATTCCACGTGTCGCCCTAGTCCCG
CAAGACGATGCCTCGTCCCCATTGTCAAGTCTGGAGTTGCATTCCATTGAACCGATAGGGGCCAATACGCCGCAT
AGTAGGCGCACAAGGCATGCCGGGTCAACAAAACCCTCCGAAGTCGACGAGATGTTCAACGTCGTGCAGTCAGCA
GCAGCAGAGAACTATGGAACTCAAGACACAAATAGGAAAACAGCCTCGATACACCCGCGCAGGAACACGATCTGG
CGACTAGCTAGCGCGTGCCTGATGAACTTTGGCAACGGAATGAACGACAGTGCACCCGGTGCCCTAATCCCTTAT
ATTGAGGATGATTACGGGATTGGCTACGCCATCATCTCACTGATCTTCATCGCCAACGCCGTCGGATTCGTTCTT
GCCGCGCCCCTTACTCACACAATCCAAGCCCGAATCGGCCACGCCAAAAGCTATGCTCTCTCGATGAGTCTCGTC
ACAGCGGGCTACGTTGCCATCGTATGCCACCCGCCCTTTCCGGTCGTTGTCACGGCGTTTCTCCTCCTCGGCTTC
GGGATGGCGTTAAGCATCGCGCTTAACAATGTCTTCTGCGCAAACCTAAACAGCTATGCCACAGCACTGGGCTTT
TTCTCCGGTGCGTATGGCATCGGTGGGGTGATCTCCCCACTATTGGCCACGGCCATGGTGTCACACGGCATCCGC
TGGACATACCTTCTACTTCATCACACTGGTGATTTCGACGTTGAATATGTTGCTTGCGGCTGTCGTCTTTCGCAA
TTATAA
Gene >Ani_SJS100_1|g11324.t1
ATGACCAGCAAGTCTGCCGGGCTCTCCGCAGCCGAACCGATATTTCCACAAATTCCACGTGTCGCCCTAGTCCCG
CAAGACGATGCCTCGTCCCCATTGTCAAGTCTGGAGTTGCATTCCATTGAACCGATAGGGGCCAATACGCCGCAT
AGTAGGCGCACAAGGCATGCCGGGTCAACAAAACCCTCCGAAGTCGACGAGATGTTCAACGTCGTGCAGTCAGCA
GCAGCAGAGAACTATGGAACTCAAGACACAAATAGGAAAACAGCCTCGATACACCCGCGCAGGAACACGATCTGG
CGACTAGCTAGCGCGTGCCTGATGAACTTTGGCAACGGAATGAACGACAGTGCACCCGGTGCCCTAATCCCTTAT
ATTGAGGATGATTACGGGATTGGCTACGCCATCATCTCACTGATCTTCATCGCCAACGCCGTCGGATTCGTTCTT
GCCGCGCCCCTTACTCACACAATCCAAGCCCGAATCGGCCACGCCAAAAGCTATGCTCTCTCGATGAGTCTCGTC
ACAGCGGGCTACGTTGCCATCGTATGCCACCCGCCCTTTCCGGTCGTTGTCACGGCGTTTCTCCTCCTCGGCTTC
GGGATGGCGTTAAGCATCGCGCTTAACAATGTCTTCTGCGCAAACCTAAACAGCTATGCCACAGCACTGGGCTTT
TTCTCCGGTGCGTATGGCATCGGTGGGGTGATCTCCCCACTATTGGCCACGGCCATGGTGTCACACGGCATCCGC
TGGACATACCTTCTACTTCATCACACTGGTGATTTCGACGTTGAATATGTTGCTTGCGGCTGTCGTCTTTCGCAA
TTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail