Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g11080.t1
Gene name
Locationscaffold_154:3624..4958
Strand-
Gene length (bp)1334
Transcript length (bp)987
Coding sequence length (bp)987
Protein length (aa) 329

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 45 67 22
3 91 113 22
4 125 147 22
5 173 195 22
6 202 221 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g11080.t1
MALPLGAVRQAVVSFIVGPMALIAVVLRLWSRYLQGRKLAANDYLALVALVLAESALSVFLAAGFAAGLGVHLEE
LLATAPQKFALHMKLFVPAQLLWAAANSCVKASILFLYIDLFPNKVFCRVCYGTLCITAAYFTMVLIEAFALCKP
VQYNWDKSIEGQCTGENVAYLVAGIVNLTIDTFIVILPMPLVFNLQLILTKKVAVAAMFSLGALVIWLWTWNLAD
MTYTVTPGAIYSVLEPALGVVNACLPTIKPAITELFGTGMLQGTSSNSGGNYSSRSSSRKLNGKVKGNLTREFER
LDDEIALYDVHSDRHSSDDHKSSSPSLP*
Coding >Ani_SJS100_1|g11080.t1
ATGGCGCTCCCCTTAGGCGCCGTGCGGCAAGCTGTGGTATCATTCATCGTGGGCCCCATGGCTCTCATTGCTGTG
GTGCTCAGACTGTGGTCTAGGTATCTCCAGGGGAGAAAGCTGGCCGCAAATGATTACTTAGCATTGGTAGCATTG
GTGCTGGCGGAATCAGCTTTGTCCGTGTTCCTGGCAGCTGGCTTTGCAGCTGGCCTAGGAGTTCATCTAGAAGAG
CTTTTGGCAACAGCACCTCAAAAGTTCGCTCTGCACATGAAGCTTTTCGTCCCTGCCCAACTTCTGTGGGCCGCG
GCCAACTCGTGTGTCAAGGCATCAATATTATTCCTATACATAGACCTCTTTCCCAACAAGGTCTTTTGCCGTGTG
TGCTATGGCACCCTCTGCATCACTGCCGCGTATTTCACCATGGTACTCATCGAAGCCTTCGCGCTTTGCAAACCT
GTCCAATACAACTGGGATAAATCGATTGAAGGGCAATGTACCGGTGAAAATGTTGCTTACCTCGTTGCTGGCATT
GTCAATCTCACCATTGACACCTTCATTGTAATATTACCGATGCCTCTGGTCTTCAACTTGCAACTGATTCTAACC
AAAAAAGTTGCCGTCGCTGCAATGTTCAGCCTAGGAGCGTTGGTCATTTGGTTATGGACTTGGAATTTGGCGGAT
ATGACCTACACCGTTACGCCTGGTGCCATTTATTCGGTATTGGAACCAGCCCTTGGGGTTGTAAACGCGTGTTTG
CCCACAATAAAACCTGCTATCACCGAGCTATTTGGAACTGGCATGCTTCAAGGCACAAGTTCCAACAGCGGGGGC
AACTATAGTAGCAGATCATCGAGTCGAAAGCTCAACGGAAAAGTGAAAGGCAATCTTACACGGGAATTCGAGCGT
CTTGATGATGAAATTGCGCTTTATGACGTACACAGCGACAGGCATTCTAGCGATGACCACAAGTCGTCGAGTCCA
AGTTTACCTTGA
Transcript >Ani_SJS100_1|g11080.t1
ATGGCGCTCCCCTTAGGCGCCGTGCGGCAAGCTGTGGTATCATTCATCGTGGGCCCCATGGCTCTCATTGCTGTG
GTGCTCAGACTGTGGTCTAGGTATCTCCAGGGGAGAAAGCTGGCCGCAAATGATTACTTAGCATTGGTAGCATTG
GTGCTGGCGGAATCAGCTTTGTCCGTGTTCCTGGCAGCTGGCTTTGCAGCTGGCCTAGGAGTTCATCTAGAAGAG
CTTTTGGCAACAGCACCTCAAAAGTTCGCTCTGCACATGAAGCTTTTCGTCCCTGCCCAACTTCTGTGGGCCGCG
GCCAACTCGTGTGTCAAGGCATCAATATTATTCCTATACATAGACCTCTTTCCCAACAAGGTCTTTTGCCGTGTG
TGCTATGGCACCCTCTGCATCACTGCCGCGTATTTCACCATGGTACTCATCGAAGCCTTCGCGCTTTGCAAACCT
GTCCAATACAACTGGGATAAATCGATTGAAGGGCAATGTACCGGTGAAAATGTTGCTTACCTCGTTGCTGGCATT
GTCAATCTCACCATTGACACCTTCATTGTAATATTACCGATGCCTCTGGTCTTCAACTTGCAACTGATTCTAACC
AAAAAAGTTGCCGTCGCTGCAATGTTCAGCCTAGGAGCGTTGGTCATTTGGTTATGGACTTGGAATTTGGCGGAT
ATGACCTACACCGTTACGCCTGGTGCCATTTATTCGGTATTGGAACCAGCCCTTGGGGTTGTAAACGCGTGTTTG
CCCACAATAAAACCTGCTATCACCGAGCTATTTGGAACTGGCATGCTTCAAGGCACAAGTTCCAACAGCGGGGGC
AACTATAGTAGCAGATCATCGAGTCGAAAGCTCAACGGAAAAGTGAAAGGCAATCTTACACGGGAATTCGAGCGT
CTTGATGATGAAATTGCGCTTTATGACGTACACAGCGACAGGCATTCTAGCGATGACCACAAGTCGTCGAGTCCA
AGTTTACCTTGA
Gene >Ani_SJS100_1|g11080.t1
ATGGCGCTCCCCTTAGGCGCCGTGCGGCAAGCTGTGGTATCATTCATCGTGGGCCCCATGGCTCTCATTGCTGTG
GTGCTCAGACTGTGGTCTAGGTATCTCCAGGGGAGAAAGCTGGCCGCAAATGATTACTTAGCATTGGTAGCATTG
GTGCTGGCGGAATCAGCTTTGTCCGTGTTCCTGGCAGGTAGGTTTGTTGAACGTTGAGCTCTCTTCAAATTGAAC
AGACAACAGTTTGAACTCACACTTTACACAGCTGGCTTTGCAGCTGGCCTAGGAGTTCATCTAGAAGAGCTTTTG
GCAACAGCACCTCAAAAGTTCGCTCTGCACATGAAGGTGAGTTCATGGGTATTGCCCAGTTTCCTACCCTACCCG
CCCGGCTAATTGTCCTTCACCACTTGTTTAGCTTTTCGTCCCTGCCCAACTTCTGTGGGCCGCGGCCAACTCGTG
TGTCAAGGCATCAATATTATTCCTATACATAGACCTCTTTCCCAACAAGGTCTTTTGCCGTGTGTGCTATGGCAC
CCTCTGCATCACTGCCGCGTATTTCACCATGGTACTCATCGAAGCCTTCGCGCTTTGCAAACCTGTCCAATACAA
CTGGGATAAATCGATTGAAGGGCAATGTACCGGTGAAAATGTTGCTTACCTCGTTGCTGGCATTGTCAATCTCAC
CATTGACACCTTCATTGTAATATTACCGATGCCTCTGGTCTTCAACTTGCAACTGATTCTAACCAAAAAAGTTGC
CGTCGCTGCAATGTTCAGCCTAGGAGCGTTGTAAGTGGACATACCCCACTCCCAACATTTGCTCTTTTCTGGTTC
TGTTACCTTCTATCCCGCCGAAATAGGTGACTTACTTTGTTCACTCTTGCTAGGATTTGTATTATATCTCTATTA
AGGGTCATTTGGTTATGGACTTGGAATTTGGCGGATATGACCTACACCGTTACGCCTGGTGCCATTTATTCGGTA
TTGGAACCAGCCCTTGGGGTTGTAAACGCGTGTTTGCCCACAATAAAACCTGCTATCACCGAGCTATTTGGAACG
TACGTACTCCTGTATTGCTTGATTTCTTGAGGAGAATTCTCGATTCAATTCTTCCATTGAAAGCTTTTCAACTAA
CACTTAACAGTGGCATGCTTCAAGGCACAAGTTCCAACAGCGGGGGCAACTATAGTAGCAGATCATCGAGTCGAA
AGCTCAACGGAAAAGTGAAAGGCAATCTTACACGGGAATTCGAGCGTCTTGATGATGAAATTGCGCTTTATGACG
TACACAGCGACAGGCATTCTAGCGATGACCACAAGTCGTCGAGTCCAAGTTTACCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail