Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g11057.t1
Gene name
Locationscaffold_152:2445..4145
Strand-
Gene length (bp)1700
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04037 DUF382 Domain of unknown function (DUF382) 1.3E-59 129 254
PF04046 PSP PSP 5.1E-20 263 308

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0110165 cellular anatomical entity No
GO:0043227 membrane-bounded organelle No
GO:0043226 organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g11057.t1
MGKNQLRRARKKALKLQATETSSNTPRAQTQVDENLSPSIPKAASTELQTTVPPDFTDPLWQMYKDVVDKFDEPE
DEKSALKERPKPEIYFDDDNEIPDEEEKESSLSKRKRKELNKLSVAELKAMVRRPEIVEWTDTSAPDPRLLVHLK
AQRNVVPVPSHWSLKREYLSSKRGIEKPPFALPKFIQETGISEMRDAALEKQEQATLKQKQRERVQPKMGRLDID
YQKLYEAFFRFQTKPELTRYGEVYYEGKEYETNLRHLRPGELSAELKEALNMPPGAPPPWLINQQRYGPPPSYPA
LKIPGLNAPPPPGAMWGYHPGGYGKPPVDEHNRPLYGGDIFGVLQPQQSVQQGEPIEKDLWGELQEPDMSEDESE
EEEEAESADDDDDDVEAGVQTPSGIETPSGLASAVPSEMTGPENIAGEFDVRKHYRGTQTEESVGQRSAFQVIPE
RQTQVQGFFGADRAYDLGASSNTMPVLGSEENGKKRKRPGDVDVSVDPDALHANDGIDREDIKRLYESQKKMSNP
GWDFQEDLSDMIAHESRKRLK*
Coding >Ani_SJS100_1|g11057.t1
ATGGGCAAGAACCAGTTGAGGCGGGCTAGGAAAAAGGCCCTTAAATTACAGGCGACTGAGACGTCTTCGAACACG
CCCCGTGCGCAGACCCAGGTTGATGAAAACCTATCGCCAAGTATCCCCAAAGCTGCTAGTACAGAGCTACAAACC
ACGGTGCCCCCGGATTTTACCGATCCACTATGGCAGATGTACAAGGATGTTGTTGATAAATTTGACGAACCGGAA
GATGAAAAGTCGGCTTTGAAAGAGCGTCCAAAACCAGAAATCTATTTCGACGATGATAACGAAATACCAGATGAG
GAAGAGAAAGAATCTTCTTTATCGAAAAGGAAGAGAAAAGAATTGAATAAGCTTTCTGTCGCCGAACTCAAAGCG
ATGGTTCGAAGACCTGAAATAGTTGAATGGACAGATACATCAGCCCCTGACCCTCGATTGCTTGTCCATTTAAAA
GCACAACGCAACGTTGTCCCTGTGCCTTCACATTGGTCGCTGAAACGGGAATACCTGTCCTCCAAGAGAGGTATA
GAAAAGCCGCCATTTGCTCTTCCCAAGTTCATCCAGGAGACCGGGATTTCGGAGATGCGCGATGCTGCCTTGGAG
AAGCAGGAGCAGGCAACGTTGAAACAGAAACAAAGGGAGCGAGTTCAGCCAAAAATGGGGAGATTGGACATCGAT
TATCAAAAGTTATACGAGGCATTCTTCCGGTTCCAGACTAAGCCGGAGCTTACGCGGTATGGCGAGGTCTATTAT
GAGGGCAAAGAATACGAGACCAATCTTAGACACCTCCGGCCGGGGGAGCTGAGTGCTGAGCTGAAAGAAGCGCTT
AACATGCCACCTGGCGCCCCTCCTCCTTGGTTGATCAATCAACAACGATACGGCCCACCCCCTTCTTATCCGGCT
CTGAAGATTCCCGGTCTCAATGCCCCTCCGCCTCCTGGCGCTATGTGGGGATATCATCCTGGAGGTTATGGAAAG
CCGCCAGTCGATGAGCACAACAGACCTTTGTACGGTGGCGACATATTTGGTGTGCTACAGCCCCAGCAATCGGTG
CAGCAGGGCGAACCCATTGAAAAGGACCTGTGGGGAGAATTGCAAGAACCTGATATGTCAGAAGACGAAAGCGAG
GAAGAGGAAGAAGCGGAAAGTGCAGATGATGATGATGATGATGTTGAGGCAGGAGTGCAGACCCCAAGTGGAATC
GAGACCCCCAGTGGTTTGGCTTCTGCTGTTCCATCTGAGATGACAGGTCCCGAGAACATTGCTGGTGAGTTCGAC
GTACGGAAGCACTATCGGGGGACTCAGACCGAAGAATCAGTGGGCCAAAGAAGCGCTTTCCAGGTCATTCCCGAG
AGACAGACGCAAGTGCAGGGGTTTTTCGGTGCTGATAGGGCCTATGACCTTGGTGCATCCTCGAACACTATGCCT
GTGCTCGGCTCTGAAGAGAATGGCAAGAAGCGCAAAAGGCCTGGAGACGTTGACGTGTCTGTTGATCCGGATGCT
TTGCACGCGAATGATGGCATTGATCGAGAAGACATAAAAAGGTTGTACGAATCCCAGAAAAAGATGAGCAATCCA
GGCTGGGATTTTCAGGAGGATCTCAGCGACATGATCGCGCATGAGAGCCGAAAAAGGCTCAAATAG
Transcript >Ani_SJS100_1|g11057.t1
ATGGGCAAGAACCAGTTGAGGCGGGCTAGGAAAAAGGCCCTTAAATTACAGGCGACTGAGACGTCTTCGAACACG
CCCCGTGCGCAGACCCAGGTTGATGAAAACCTATCGCCAAGTATCCCCAAAGCTGCTAGTACAGAGCTACAAACC
ACGGTGCCCCCGGATTTTACCGATCCACTATGGCAGATGTACAAGGATGTTGTTGATAAATTTGACGAACCGGAA
GATGAAAAGTCGGCTTTGAAAGAGCGTCCAAAACCAGAAATCTATTTCGACGATGATAACGAAATACCAGATGAG
GAAGAGAAAGAATCTTCTTTATCGAAAAGGAAGAGAAAAGAATTGAATAAGCTTTCTGTCGCCGAACTCAAAGCG
ATGGTTCGAAGACCTGAAATAGTTGAATGGACAGATACATCAGCCCCTGACCCTCGATTGCTTGTCCATTTAAAA
GCACAACGCAACGTTGTCCCTGTGCCTTCACATTGGTCGCTGAAACGGGAATACCTGTCCTCCAAGAGAGGTATA
GAAAAGCCGCCATTTGCTCTTCCCAAGTTCATCCAGGAGACCGGGATTTCGGAGATGCGCGATGCTGCCTTGGAG
AAGCAGGAGCAGGCAACGTTGAAACAGAAACAAAGGGAGCGAGTTCAGCCAAAAATGGGGAGATTGGACATCGAT
TATCAAAAGTTATACGAGGCATTCTTCCGGTTCCAGACTAAGCCGGAGCTTACGCGGTATGGCGAGGTCTATTAT
GAGGGCAAAGAATACGAGACCAATCTTAGACACCTCCGGCCGGGGGAGCTGAGTGCTGAGCTGAAAGAAGCGCTT
AACATGCCACCTGGCGCCCCTCCTCCTTGGTTGATCAATCAACAACGATACGGCCCACCCCCTTCTTATCCGGCT
CTGAAGATTCCCGGTCTCAATGCCCCTCCGCCTCCTGGCGCTATGTGGGGATATCATCCTGGAGGTTATGGAAAG
CCGCCAGTCGATGAGCACAACAGACCTTTGTACGGTGGCGACATATTTGGTGTGCTACAGCCCCAGCAATCGGTG
CAGCAGGGCGAACCCATTGAAAAGGACCTGTGGGGAGAATTGCAAGAACCTGATATGTCAGAAGACGAAAGCGAG
GAAGAGGAAGAAGCGGAAAGTGCAGATGATGATGATGATGATGTTGAGGCAGGAGTGCAGACCCCAAGTGGAATC
GAGACCCCCAGTGGTTTGGCTTCTGCTGTTCCATCTGAGATGACAGGTCCCGAGAACATTGCTGGTGAGTTCGAC
GTACGGAAGCACTATCGGGGGACTCAGACCGAAGAATCAGTGGGCCAAAGAAGCGCTTTCCAGGTCATTCCCGAG
AGACAGACGCAAGTGCAGGGGTTTTTCGGTGCTGATAGGGCCTATGACCTTGGTGCATCCTCGAACACTATGCCT
GTGCTCGGCTCTGAAGAGAATGGCAAGAAGCGCAAAAGGCCTGGAGACGTTGACGTGTCTGTTGATCCGGATGCT
TTGCACGCGAATGATGGCATTGATCGAGAAGACATAAAAAGGTTGTACGAATCCCAGAAAAAGATGAGCAATCCA
GGCTGGGATTTTCAGGAGGATCTCAGCGACATGATCGCGCATGAGAGCCGAAAAAGGCTCAAATAG
Gene >Ani_SJS100_1|g11057.t1
ATGGGCAAGAACCAGTTGAGGCGGGCTAGGAAAAAGGCCCTTAAATTACAGGTATGATTCGTGCAGATTCTGAAT
TGGAGAAATGCTCACTCTTCTCGTCTATTTATAAGGCGACTGAGACGTCTTCGAACACGCCCCGTGCGCAGACCC
AGGTTGATGAAAACCTATCGCCAAGTATCCCCAAAGCTGCTAGTACAGAGCTACAAACCACGGTGCCCCCGGATT
TTACCGATCCACTATGGCAGATGTACAAGGATGTTGTTGATAAATTTGACGAACCGGAAGATGAAAAGTCGGCTT
TGAAAGAGCGTCCAAAACCAGAAATCTATTTCGACGATGATAACGAAATACCAGATGAGGAAGAGAAAGAATCTT
CTTTATCGAAAAGGAAGAGAAAAGAATTGAATAAGCTTTCTGTCGCCGAACTCAAAGCGATGGTTCGAAGACCTG
AAATAGTTGAATGGACAGATACATCAGCCCCTGACCCTCGATTGCTTGTCCATTTAAAAGCACAACGCAACGTTG
TCCCTGTGCCTTCACATTGGTCGCTGAAACGGGAATACCTGTCCTCCAAGAGAGGTATAGAAAAGCCGCCATTTG
CTCTTCCCAAGTTCATCCAGGAGACCGGGATTTCGGAGATGCGCGATGCTGCCTTGGAGAAGCAGGAGCAGGCAA
CGTTGAAACAGAAACAAAGGGAGCGAGTTCAGCCAAAAATGGGGAGATTGGACATCGATTATCAAAAGTTATACG
AGGCATTCTTCCGGTTCCAGACTAAGCCGGAGCTTACGCGGTATGGCGAGGTCTATTATGAGGGCAAAGAATACG
AGACCAATCTTAGACACCTCCGGCCGGGGGAGCTGAGTGCTGAGCTGAAAGAAGCGCTTAACATGCCACCTGGCG
CCCCTCCTCCTTGGTTGATCAATCAACAACGATACGGCCCACCCCCTTCTTATCCGGCTCTGAAGATTCCCGGTC
TCAATGCCCCTCCGCCTCCTGGCGCTATGTGGGGATATCATCCTGGAGGTTATGGAAAGCCGCCAGTCGATGAGC
ACAACAGACCTTTGTACGGTGGCGACATATTTGGTGTGCTACAGCCCCAGCAATCGGTGCAGCAGGGCGAACCCA
TTGAAAAGGACCTGTGGGGAGAATTGCAAGAACCTGATATGTCAGAAGACGAAAGCGAGGAAGAGGAAGAAGCGG
AAAGTGCAGATGATGATGATGATGATGTTGAGGCAGGAGTGCAGACCCCAAGTGGAATCGAGACCCCCAGTGGTT
TGGCTTCTGCTGTTCCATCTGAGATGACAGGTCCCGAGAACATTGCTGGTGAGTTCGACGTACGGAAGCACTATC
GGGGGACTCAGACCGAAGAATCAGTGGGCCAAAGAAGCGCTTTCCAGGTCATTCCCGAGAGACAGACGCAAGTGC
AGGGGTTTTTCGGTGCTGATAGGGCCTATGACCTTGGTGCATCCTCGAACACTATGCCTGTGCTCGGCTCTGAAG
AGAATGGCAAGAAGCGCAAAAGGCCTGGAGACGTTGACGTGTCTGTTGATCCGGATGCTTTGCACGCGAATGATG
GCATTGATCGAGAAGACATAAAAAGGTTGTACGAATCCCAGAAAAAGATGAGCAATCCAGGCTGGGATTTTCAGG
AGGATCTCAGCGACATGATCGCGCATGAGAGCCGAAAAAGGCTCAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail