© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ani_SJS100_1|g10745.t1 |
| Gene name | |
| Location | scaffold_131:51003..51231 |
| Strand | - |
| Gene length (bp) | 228 |
| Transcript length (bp) | 228 |
| Coding sequence length (bp) | 228 |
| Protein length (aa) | 76 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF10471 | ANAPC_CDC26 | Anaphase-promoting complex APC subunit CDC26 | 2.3E-12 | 1 | 59 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005680 | anaphase-promoting complex | Yes |
| GO:0030071 | regulation of mitotic metaphase/anaphase transition | Yes |
| GO:0031145 | anaphase-promoting complex-dependent catabolic process | Yes |
| GO:0030163 | protein catabolic process | No |
| GO:1902099 | regulation of metaphase/anaphase transition of cell cycle | No |
| GO:0010564 | regulation of cell cycle process | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:1990234 | transferase complex | No |
| GO:0050794 | regulation of cellular process | No |
| GO:0043632 | modification-dependent macromolecule catabolic process | No |
| GO:0009056 | catabolic process | No |
| GO:0008152 | metabolic process | No |
| GO:0006511 | ubiquitin-dependent protein catabolic process | No |
| GO:0009987 | cellular process | No |
| GO:1901987 | regulation of cell cycle phase transition | No |
| GO:0031461 | cullin-RING ubiquitin ligase complex | No |
| GO:0065007 | biological regulation | No |
| GO:0050789 | regulation of biological process | No |
| GO:0140513 | nuclear protein-containing complex | No |
| GO:0032991 | protein-containing complex | No |
| GO:0044238 | primary metabolic process | No |
| GO:0140535 | intracellular protein-containing complex | No |
| GO:0019538 | protein metabolic process | No |
| GO:1902494 | catalytic complex | No |
| GO:0043170 | macromolecule metabolic process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:1905818 | regulation of chromosome separation | No |
| GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process | No |
| GO:0010498 | proteasomal protein catabolic process | No |
| GO:0051603 | proteolysis involved in protein catabolic process | No |
| GO:1901575 | organic substance catabolic process | No |
| GO:0051128 | regulation of cellular component organization | No |
| GO:0000152 | nuclear ubiquitin ligase complex | No |
| GO:0044260 | cellular macromolecule metabolic process | No |
| GO:1901565 | organonitrogen compound catabolic process | No |
| GO:0005575 | cellular_component | No |
| GO:1901990 | regulation of mitotic cell cycle phase transition | No |
| GO:0007346 | regulation of mitotic cell cycle | No |
| GO:0033045 | regulation of sister chromatid segregation | No |
| GO:0019941 | modification-dependent protein catabolic process | No |
| GO:0033043 | regulation of organelle organization | No |
| GO:0006508 | proteolysis | No |
| GO:0044265 | cellular macromolecule catabolic process | No |
| GO:0044248 | cellular catabolic process | No |
| GO:0008150 | biological_process | No |
| GO:0033044 | regulation of chromosome organization | No |
| GO:0009057 | macromolecule catabolic process | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0051983 | regulation of chromosome segregation | No |
| GO:0051726 | regulation of cell cycle | No |
| GO:0010965 | regulation of mitotic sister chromatid separation | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0000151 | ubiquitin ligase complex | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 12 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ani_SJS100_1|g10745.t1 MLRRKPTAIAITSEDLATFEQSRLRQLSKETRTEGHASTSSNVNIDPSDELKPLPGDKARIVRSREERIGINRRN * |
| Coding | >Ani_SJS100_1|g10745.t1 ATGTTACGCCGCAAACCCACCGCTATAGCTATAACCTCGGAAGACCTTGCGACTTTTGAACAATCACGGCTCCGA CAGCTCTCCAAAGAGACTCGTACCGAAGGCCATGCCAGCACTAGCTCCAATGTCAATATTGACCCCAGCGATGAG CTCAAGCCATTGCCGGGGGACAAGGCGAGAATCGTCCGCTCGCGGGAAGAGCGCATCGGTATTAATCGACGCAAT TAA |
| Transcript | >Ani_SJS100_1|g10745.t1 ATGTTACGCCGCAAACCCACCGCTATAGCTATAACCTCGGAAGACCTTGCGACTTTTGAACAATCACGGCTCCGA CAGCTCTCCAAAGAGACTCGTACCGAAGGCCATGCCAGCACTAGCTCCAATGTCAATATTGACCCCAGCGATGAG CTCAAGCCATTGCCGGGGGACAAGGCGAGAATCGTCCGCTCGCGGGAAGAGCGCATCGGTATTAATCGACGCAAT TAA |
| Gene | >Ani_SJS100_1|g10745.t1 ATGTTACGCCGCAAACCCACCGCTATAGCTATAACCTCGGAAGACCTTGCGACTTTTGAACAATCACGGCTCCGA CAGCTCTCCAAAGAGACTCGTACCGAAGGCCATGCCAGCACTAGCTCCAATGTCAATATTGACCCCAGCGATGAG CTCAAGCCATTGCCGGGGGACAAGGCGAGAATCGTCCGCTCGCGGGAAGAGCGCATCGGTATTAATCGACGCAAT TAA |