Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g10649.t1
Gene name
Locationscaffold_126:9753..10455
Strand+
Gene length (bp)702
Transcript length (bp)645
Coding sequence length (bp)645
Protein length (aa) 215

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 3.7E-21 37 204

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0005575 cellular_component No
GO:0016020 membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

Domain # Start End Length
1 110 129 19
2 141 163 22
3 186 208 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g10649.t1
MDSAASEASTAVEGIATKASTAAGTVVSQASDALRTLEKELQSELPAYYTVGLWGYCEGNDTQVVSCSRPSISFT
FNISGILNSASTEIDELVSRIDDRVLTGYYDVSRAVIWLYISGFVAATLTALLGNRKTFFDGGNKLVFTFCVLSL
ALIMSATIGVNVIYRVNTSGINTVLGSFGASASLGTHMLAAAWLAFAFSSSALLLWLIQSYCCS*
Coding >Ani_SJS100_1|g10649.t1
ATGGATAGTGCAGCTTCTGAAGCTTCTACTGCCGTTGAGGGTATCGCAACCAAGGCTTCTACTGCCGCCGGAACG
GTTGTAAGCCAAGCGAGCGATGCGCTTCGGACCTTGGAAAAAGAACTCCAGTCAGAGCTCCCGGCGTATTACACC
GTCGGCTTGTGGGGCTACTGCGAAGGCAACGATACTCAAGTCGTCTCCTGTTCCCGGCCAAGCATATCTTTCACG
TTCAATATCTCCGGCATTCTGAATTCTGCTTCGACAGAGATCGATGAACTGGTTTCAAGAATCGACGATAGAGTC
CTCACTGGATATTACGACGTATCGAGGGCGGTTATTTGGTTATATATCTCTGGCTTCGTCGCAGCGACCCTTACA
GCACTTCTGGGTAATAGGAAGACGTTTTTTGATGGAGGAAATAAGCTGGTCTTTACTTTCTGCGTGCTTTCCTTG
GCCCTTATCATGTCCGCAACGATCGGCGTAAACGTCATATACCGTGTGAACACTTCCGGGATCAATACAGTTCTG
GGCAGCTTTGGCGCTTCGGCCAGTCTTGGAACGCACATGCTAGCCGCTGCTTGGCTTGCATTCGCATTTTCCAGT
AGTGCCTTGCTGCTCTGGCTGATCCAGTCATATTGCTGTAGCTGA
Transcript >Ani_SJS100_1|g10649.t1
ATGGATAGTGCAGCTTCTGAAGCTTCTACTGCCGTTGAGGGTATCGCAACCAAGGCTTCTACTGCCGCCGGAACG
GTTGTAAGCCAAGCGAGCGATGCGCTTCGGACCTTGGAAAAAGAACTCCAGTCAGAGCTCCCGGCGTATTACACC
GTCGGCTTGTGGGGCTACTGCGAAGGCAACGATACTCAAGTCGTCTCCTGTTCCCGGCCAAGCATATCTTTCACG
TTCAATATCTCCGGCATTCTGAATTCTGCTTCGACAGAGATCGATGAACTGGTTTCAAGAATCGACGATAGAGTC
CTCACTGGATATTACGACGTATCGAGGGCGGTTATTTGGTTATATATCTCTGGCTTCGTCGCAGCGACCCTTACA
GCACTTCTGGGTAATAGGAAGACGTTTTTTGATGGAGGAAATAAGCTGGTCTTTACTTTCTGCGTGCTTTCCTTG
GCCCTTATCATGTCCGCAACGATCGGCGTAAACGTCATATACCGTGTGAACACTTCCGGGATCAATACAGTTCTG
GGCAGCTTTGGCGCTTCGGCCAGTCTTGGAACGCACATGCTAGCCGCTGCTTGGCTTGCATTCGCATTTTCCAGT
AGTGCCTTGCTGCTCTGGCTGATCCAGTCATATTGCTGTAGCTGA
Gene >Ani_SJS100_1|g10649.t1
ATGGATAGTGCAGCTTCTGAAGCTTCTACTGCCGTTGAGGGTATCGCAACCAAGGCTTCTACTGCCGCCGGAACG
GTTGTAAGCCAAGCGAGCGATGCGCTTCGGACCTTGGAAAAAGAACTCCAGTCAGAGCTCCCGGCGTATTACACC
GTCGGCTTGTGGGGCTACTGCGAAGGCAACGATACTCAAGTCGTCTCCTGTTCCCGGCCAAGCATATCTTTCACG
TTCAATATCTCCGGCATTCTGAATTCTGCTTCGACAGAGATCGATGAACTGGTTTCAAGAATCGACGATAGAGTC
CTCACTGGATATTACGACGTATCGAGGGCGGTTATTTGGTTATATATCTCTGGCTTCGTCGCAGCGACCCTTACA
GCACTTCTGGGTAATAGGAAGACGTTTTTTGATGGAGGAAATAAGCTGGTCTTTACTTTCTGCGTGGTATGTCTG
TTATCATTGGGGTCGGAGATACGAGTACGGACTTGCTAACTGTTCCAGCTTTCCTTGGCCCTTATCATGTCCGCA
ACGATCGGCGTAAACGTCATATACCGTGTGAACACTTCCGGGATCAATACAGTTCTGGGCAGCTTTGGCGCTTCG
GCCAGTCTTGGAACGCACATGCTAGCCGCTGCTTGGCTTGCATTCGCATTTTCCAGTAGTGCCTTGCTGCTCTGG
CTGATCCAGTCATATTGCTGTAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail