Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g1061.t1
Gene name
Locationscaffold_003:739248..740271
Strand-
Gene length (bp)1023
Transcript length (bp)717
Coding sequence length (bp)717
Protein length (aa) 239

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00355 Rieske Rieske [2Fe-2S] domain 4.1E-11 169 224
PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region 3.1E-10 57 109

GO

GO Term Description Terminal node
GO:0008121 ubiquinol-cytochrome-c reductase activity Yes
GO:0051537 2 iron, 2 sulfur cluster binding Yes
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0015453 oxidoreduction-driven active transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0051540 metal cluster binding No
GO:0016679 oxidoreductase activity, acting on diphenols and related substances as donors No
GO:0015075 ion transmembrane transporter activity No
GO:0051536 iron-sulfur cluster binding No
GO:0003824 catalytic activity No
GO:0022804 active transmembrane transporter activity No
GO:0022853 active ion transmembrane transporter activity No
GO:0009055 electron transfer activity No
GO:0022857 transmembrane transporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0005488 binding No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g1061.t1
MSLSAASSSILRACARQQLPSSRAAIASCQQRRGVADASKSTFDSPFGSSKEYSSTLKIPDFSKYQSKKPPRSNQ
VFSYFMAGSLGLASAVGAKATVQDFLVNMSASADVLAQAKVEIGLGAIPEGKNVIIKWRGKPVFIRHRTQDEIQE
AQKTEWQSLRDPQADEDRVQKPEWLVMLGVCTHLGCVPIGESGDYGGWFCPCHGSHYDISGRIRKGPAPLNLEVP
QYNFPSEDTLVIG*
Coding >Ani_SJS100_1|g1061.t1
ATGTCTCTCTCCGCCGCTTCCAGCTCTATCCTGCGCGCTTGCGCCCGGCAACAACTGCCCTCTTCTCGCGCCGCC
ATTGCCTCCTGCCAGCAGCGGAGGGGAGTCGCTGATGCCTCCAAGTCCACTTTCGATAGCCCCTTCGGCAGCTCC
AAGGAGTACTCTTCCACCCTGAAGATCCCCGATTTCAGCAAATACCAGTCCAAGAAGCCCCCACGCTCCAACCAG
GTCTTCTCTTACTTCATGGCCGGTTCCCTCGGTCTGGCCTCTGCCGTCGGTGCTAAGGCCACCGTCCAGGACTTC
CTGGTCAACATGTCCGCCTCCGCCGATGTCCTCGCCCAGGCTAAGGTTGAGATTGGCCTTGGTGCCATCCCTGAG
GGCAAGAACGTTATCATCAAGTGGCGTGGTAAGCCCGTCTTCATCCGTCACCGCACCCAGGACGAGATCCAGGAG
GCCCAGAAGACCGAGTGGCAGTCCCTCCGTGACCCCCAGGCCGACGAGGACCGTGTCCAGAAGCCCGAGTGGCTT
GTCATGCTTGGTGTCTGCACTCACCTTGGTTGTGTCCCCATCGGTGAATCCGGCGACTATGGCGGCTGGTTCTGC
CCCTGCCACGGTTCGCACTACGACATCTCCGGCCGTATAAGAAAGGGACCCGCTCCCCTCAACCTCGAGGTTCCC
CAATACAACTTCCCCTCCGAGGACACCCTCGTCATCGGTTAA
Transcript >Ani_SJS100_1|g1061.t1
ATGTCTCTCTCCGCCGCTTCCAGCTCTATCCTGCGCGCTTGCGCCCGGCAACAACTGCCCTCTTCTCGCGCCGCC
ATTGCCTCCTGCCAGCAGCGGAGGGGAGTCGCTGATGCCTCCAAGTCCACTTTCGATAGCCCCTTCGGCAGCTCC
AAGGAGTACTCTTCCACCCTGAAGATCCCCGATTTCAGCAAATACCAGTCCAAGAAGCCCCCACGCTCCAACCAG
GTCTTCTCTTACTTCATGGCCGGTTCCCTCGGTCTGGCCTCTGCCGTCGGTGCTAAGGCCACCGTCCAGGACTTC
CTGGTCAACATGTCCGCCTCCGCCGATGTCCTCGCCCAGGCTAAGGTTGAGATTGGCCTTGGTGCCATCCCTGAG
GGCAAGAACGTTATCATCAAGTGGCGTGGTAAGCCCGTCTTCATCCGTCACCGCACCCAGGACGAGATCCAGGAG
GCCCAGAAGACCGAGTGGCAGTCCCTCCGTGACCCCCAGGCCGACGAGGACCGTGTCCAGAAGCCCGAGTGGCTT
GTCATGCTTGGTGTCTGCACTCACCTTGGTTGTGTCCCCATCGGTGAATCCGGCGACTATGGCGGCTGGTTCTGC
CCCTGCCACGGTTCGCACTACGACATCTCCGGCCGTATAAGAAAGGGACCCGCTCCCCTCAACCTCGAGGTTCCC
CAATACAACTTCCCCTCCGAGGACACCCTCGTCATCGGTTAA
Gene >Ani_SJS100_1|g1061.t1
ATGTCTCTCTCCGCCGCTTCCAGCTCTATCCTGCGCGCTTGCGCCCGGCAACAACTGCCCTCTTCTCGCGCCGCC
ATTGCCTCCTGCCAGCAGCGGAGGGGAGTCGCTGATGCCTCCAAGTCCACTTTCGATAGCCCCTTCGGCAGCTCC
AAGGAGTACTCTTCCACCCTGAAGATCCCCGATTTCAGCAAATACCAGTCCAAGAAGCCCCCACGCTCCAACCAG
GTCTTCTCTTACTTCATGGCCGGTTCCCTCGGTCTGGCCTCTGCCGTCGGTGCTAAGGCCACCGTCCAGGGTAGG
TACCCCTGGAGACATTGAATATTGCGCATATACATGAGAAAAGAGGAGGAAAAACTAGGAGGGGGGGAATATCAG
GTTGAACAATGGGAGGGAATGGCTGTGTGCTTGACCGCTCGGGACAAATCGCTGATATGGAGTTTCTCTCATTAC
TAGACTTCCTGGTCAACATGTCCGCCTCCGCCGATGTCCTCGCCCAGGCTAAGGTTGAGATTGGCCTTGGTGCCA
TCCCTGAGGGCAAGAACGTATGTTCTATATTCTCTTTTCCCCCGAACCAGAAGGCTGGCTCGTCCCCCTTTGCAA
TCCAGCATCTGACCGATTCCGAAACAGGTTATCATCAAGTGGCGTGGTAAGCCCGTCTTCATCCGTCACCGCACC
CAGGACGAGATCCAGGAGGCCCAGAAGACCGAGTGGCAGTCCCTCCGTGACCCCCAGGCCGACGAGGACCGTGTC
CAGAAGCCCGAGTGGCTTGTCATGCTTGGTACGACATACTCCTCCCCGACCCGCCATTGACCTCCCATCTAATAT
ATATTCCCCTATCTAGGTGTCTGCACTCACCTTGGTTGTGTCCCCATCGGTGAATCCGGCGACTATGGCGGCTGG
TTCTGCCCCTGCCACGGTTCGCACTACGACATCTCCGGCCGTATAAGAAAGGGACCCGCTCCCCTCAACCTCGAG
GTTCCCCAATACAACTTCCCCTCCGAGGACACCCTCGTCATCGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail