Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g10573.t1
Gene name
Locationscaffold_122:22654..24462
Strand+
Gene length (bp)1808
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.7E-58 56 487

GO

GO Term Description Terminal node
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0003824 catalytic activity No
GO:0046906 tetrapyrrole binding No
GO:0043169 cation binding No
GO:0016491 oxidoreductase activity No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g10573.t1
MPWSAASLSLATFFSALVALQLYWDVSRSYRSRKLSKQWNCEPICRYPSGILGYKVVLRAKTAAQEGQVGSTIQG
VHLQYGNTLKVNLVGHDVVATCEPENIQAVLASQFSSFGLSEWRYPQYRPLLGRGIFTSDGTAWEHSRKLLRPQF
TKNQIPSIEWFDSHSENLMRSLPPDGHAFDIQPLAFRLALDSATGYLFGESINSLVKPDSNQTGVAETSGSGNEG
FAAAFDYAQDILFRRTLALSYYWLINPSDFRKSTRVVHKFVDYYVDKAIEYRSNIGNYKTGHEQKGEEYCFLHAL
AAETQDREFLRDQLVNVLLASRDDVASVLTSTFYLLARDTRAWWKLKQEITDAVDRHASNITLKEIQSLPYLRGV
LYEVLRLFPPVPVNARVAHHDTTIPVGGGPDGRSPVFIPKGQMVAYSVWCLHRRRDLWGADAESFRPERWEGYNP
PAWEFVPFNGGPRACLGQQFAMILISQQVFRLVQHLDSIESAQPGPDMGLNPPLRQTLTMCHEHGVHLRVKRMRI
*
Coding >Ani_SJS100_1|g10573.t1
ATGCCATGGTCTGCAGCCTCTCTGTCACTGGCCACGTTTTTCTCAGCCCTGGTCGCATTGCAGCTCTATTGGGAT
GTTAGCAGAAGCTATAGATCCAGGAAGCTGTCGAAACAATGGAATTGTGAGCCAATATGTCGCTATCCTAGTGGG
ATCCTGGGTTATAAAGTGGTTTTGCGTGCGAAAACTGCCGCCCAAGAAGGCCAAGTCGGATCTACGATACAGGGA
GTTCATTTGCAGTACGGGAATACCCTGAAAGTAAATCTTGTGGGTCACGATGTTGTCGCTACTTGCGAGCCGGAA
AATATTCAGGCTGTCCTAGCCTCTCAGTTTTCGAGTTTTGGACTATCTGAATGGCGTTATCCACAGTACCGCCCA
TTGCTTGGGAGAGGGATATTCACGTCAGATGGAACGGCTTGGGAGCACTCGAGGAAGTTGCTACGCCCACAGTTT
ACGAAGAATCAAATACCTTCAATCGAGTGGTTTGACTCTCACTCCGAGAATCTCATGCGATCACTGCCGCCCGAT
GGGCATGCCTTTGATATCCAGCCGCTTGCCTTCCGACTAGCACTTGATTCTGCAACGGGCTATCTGTTTGGCGAG
TCCATTAATTCTCTAGTGAAGCCGGATTCCAACCAAACAGGTGTTGCAGAAACGTCAGGCAGTGGAAACGAAGGA
TTTGCTGCTGCGTTCGATTACGCTCAAGATATCCTTTTCAGGCGAACTCTCGCGCTCTCATACTACTGGCTAATC
AACCCGAGCGATTTCAGGAAATCCACTCGTGTGGTTCATAAATTCGTGGATTACTACGTGGATAAGGCTATCGAA
TACAGAAGCAATATTGGCAACTACAAAACTGGCCATGAACAGAAAGGAGAAGAGTATTGTTTTCTGCATGCACTA
GCGGCTGAGACACAAGATCGGGAATTTTTGAGGGATCAGTTGGTCAATGTTCTCCTAGCTAGCAGGGACGACGTT
GCCAGCGTGCTTACCTCAACCTTTTATCTTCTTGCACGAGACACTCGTGCATGGTGGAAGTTGAAACAGGAAATC
ACCGATGCGGTAGACAGGCACGCGAGCAATATCACCCTGAAGGAGATACAGAGTCTTCCTTATCTACGCGGTGTC
TTGTACGAAGTACTTCGCCTCTTTCCGCCTGTTCCTGTAAATGCGCGAGTTGCCCATCATGATACGACAATTCCC
GTGGGCGGTGGTCCGGATGGTCGATCGCCTGTTTTTATTCCCAAGGGGCAGATGGTCGCGTATTCAGTCTGGTGC
CTTCACCGGCGTCGTGACCTCTGGGGCGCAGATGCTGAGAGCTTCCGACCGGAGAGATGGGAAGGTTACAACCCA
CCAGCGTGGGAGTTCGTGCCTTTCAATGGTGGACCCCGGGCGTGCCTTGGTCAGCAGTTTGCCATGATCCTGATT
AGCCAACAGGTATTCAGGCTAGTGCAACACCTCGATTCTATTGAGAGCGCCCAGCCAGGGCCAGACATGGGGCTC
AACCCTCCATTGAGACAGACGCTGACCATGTGTCATGAGCATGGAGTCCACTTGCGCGTCAAGCGGATGAGAATC
TGA
Transcript >Ani_SJS100_1|g10573.t1
ATGCCATGGTCTGCAGCCTCTCTGTCACTGGCCACGTTTTTCTCAGCCCTGGTCGCATTGCAGCTCTATTGGGAT
GTTAGCAGAAGCTATAGATCCAGGAAGCTGTCGAAACAATGGAATTGTGAGCCAATATGTCGCTATCCTAGTGGG
ATCCTGGGTTATAAAGTGGTTTTGCGTGCGAAAACTGCCGCCCAAGAAGGCCAAGTCGGATCTACGATACAGGGA
GTTCATTTGCAGTACGGGAATACCCTGAAAGTAAATCTTGTGGGTCACGATGTTGTCGCTACTTGCGAGCCGGAA
AATATTCAGGCTGTCCTAGCCTCTCAGTTTTCGAGTTTTGGACTATCTGAATGGCGTTATCCACAGTACCGCCCA
TTGCTTGGGAGAGGGATATTCACGTCAGATGGAACGGCTTGGGAGCACTCGAGGAAGTTGCTACGCCCACAGTTT
ACGAAGAATCAAATACCTTCAATCGAGTGGTTTGACTCTCACTCCGAGAATCTCATGCGATCACTGCCGCCCGAT
GGGCATGCCTTTGATATCCAGCCGCTTGCCTTCCGACTAGCACTTGATTCTGCAACGGGCTATCTGTTTGGCGAG
TCCATTAATTCTCTAGTGAAGCCGGATTCCAACCAAACAGGTGTTGCAGAAACGTCAGGCAGTGGAAACGAAGGA
TTTGCTGCTGCGTTCGATTACGCTCAAGATATCCTTTTCAGGCGAACTCTCGCGCTCTCATACTACTGGCTAATC
AACCCGAGCGATTTCAGGAAATCCACTCGTGTGGTTCATAAATTCGTGGATTACTACGTGGATAAGGCTATCGAA
TACAGAAGCAATATTGGCAACTACAAAACTGGCCATGAACAGAAAGGAGAAGAGTATTGTTTTCTGCATGCACTA
GCGGCTGAGACACAAGATCGGGAATTTTTGAGGGATCAGTTGGTCAATGTTCTCCTAGCTAGCAGGGACGACGTT
GCCAGCGTGCTTACCTCAACCTTTTATCTTCTTGCACGAGACACTCGTGCATGGTGGAAGTTGAAACAGGAAATC
ACCGATGCGGTAGACAGGCACGCGAGCAATATCACCCTGAAGGAGATACAGAGTCTTCCTTATCTACGCGGTGTC
TTGTACGAAGTACTTCGCCTCTTTCCGCCTGTTCCTGTAAATGCGCGAGTTGCCCATCATGATACGACAATTCCC
GTGGGCGGTGGTCCGGATGGTCGATCGCCTGTTTTTATTCCCAAGGGGCAGATGGTCGCGTATTCAGTCTGGTGC
CTTCACCGGCGTCGTGACCTCTGGGGCGCAGATGCTGAGAGCTTCCGACCGGAGAGATGGGAAGGTTACAACCCA
CCAGCGTGGGAGTTCGTGCCTTTCAATGGTGGACCCCGGGCGTGCCTTGGTCAGCAGTTTGCCATGATCCTGATT
AGCCAACAGGTATTCAGGCTAGTGCAACACCTCGATTCTATTGAGAGCGCCCAGCCAGGGCCAGACATGGGGCTC
AACCCTCCATTGAGACAGACGCTGACCATGTGTCATGAGCATGGAGTCCACTTGCGCGTCAAGCGGATGAGAATC
TGA
Gene >Ani_SJS100_1|g10573.t1
ATGCCATGGTCTGCAGCCTCTCTGTCACTGGCCACGTTTTTCTCAGCCCTGGTCGCATTGCAGCTCTATTGGGAT
GTTAGCAGAAGCTATAGATCCAGGAAGCTGTCGAAACAATGGAATTGTGAGCCAATATGTCGCTATCCTAGTGGG
ATCCTGGGTTATAAAGTGGTTTTGCGTGCGAAAACTGCCGCCCAAGAAGGCCAAGTCGGATCTACGATACAGGGA
GTTCATTTGCAGTACGGGAATACCCTGAAAGTAAATCTTGTGGGTCACGATGTTGTCGCTACTTGCGAGCCGGAA
AATATTCAGGCTGTCCTAGCCTCTCAGTTTTCGAGTTTTGGACTATCTGAATGGCGTTATCCACAGTACCGCCCA
TTGCTTGGGAGAGGGATATTCACGTCAGATGGAACGGCTTGGGAGCACTCGAGGAAGTTGCTACGCCCACAGTTT
ACGAAGAATCAAGTAGGTTGAGCAACAATAGGTTCTTCCCATGTGGCCTATCTAACGGGGTATTCCTGCTAGATA
CCTTCAATCGAGTGGTTTGACTCTCACTCCGAGAATCTCATGCGATCACTGCCGCCCGATGGGCATGCCTTTGAT
ATCCAGCCGCTTGCCTTCCGACTAGCACTTGATTCTGCAACGGGCTATCTGTTTGGCGAGTCCATTAATTCTCTA
GTGAAGCCGGATTCCAACCAAACAGGTGTTGCAGAAACGTCAGGCAGTGGAAACGAAGGATTTGCTGCTGCGTTC
GATTACGCTCAAGATATCCTTTTCAGGCGAACTCTCGCGCTCTCATACTACTGGCTAATCAACCCGAGCGATTTC
AGGAAATCCACTCGTGTGGTTCATAAATTCGTGGATTACTACGTGGATAAGGCTATCGAATACAGAAGCAATATT
GGCAACTACAAAACTGGCCATGAACAGAAAGGAGAAGAGTATTGTTTTCTGCATGCACTAGCGGCTGAGACACAA
GATCGGGAATTTTTGAGGGATCAGTTGGTCAATGTTCTCCTAGCTAGCAGGGACGACGTTGCCAGCGTGCTTACC
TCAACCTTTTATCTTCTTGCACGAGACACTCGTGCATGGTGGAAGTTGAAACAGGAAATCACCGATGCGGTAGAC
AGGCACGCGAGCAATATCACCCTGAAGGAGATACAGAGTCTTCCTTATCTACGCGGTGTCTTGTACGAAGGTGAG
CTGCACAATAGTTCTGCCAATGTCTCTTCATATCATTCAAATCTACGTCCACATTCTCAACATCTGCTAAGCATT
TGGAATAGTACTTCGCCTCTTTCCGCCTGTTCCTGTAAATGCGCGAGTTGCCCATCATGATACGACAATTCCCGT
GGGCGGTGGTCCGGATGGTCGATCGCCTGTTTTTATTCCCAAGGGGCAGATGGTCGCGTATTCAGTCTGGTGCCT
TCACCGGCGTCGTGACCTCTGGGGCGCAGATGCTGAGAGCTTCCGACCGGAGAGATGGGAAGGTTACAACCCACC
AGCGTGGGAGTTCGTGCCTTTCAATGGTGGACCCCGGGCGTGCCTTGGTCGTGAGTCCCTCCTCTTTGCACGTCA
AGTGTCCTCTAAAGAGTACTTGATGAGACTTCTCGCTAACAACAGTGCTACGAACAGAGCAGTTTGCCATGATCC
TGATTAGCCAACAGGTATTCAGGCTAGTGCAACACCTCGATTCTATTGAGAGCGCCCAGCCAGGGCCAGACATGG
GGCTCAACCCTCCATTGAGACAGACGCTGACCATGTGTCATGAGCATGGAGTCCACTTGCGCGTCAAGCGGATGA
GAATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail