Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g10558.t1
Gene name
Locationscaffold_121:59954..63524
Strand+
Gene length (bp)3570
Transcript length (bp)2649
Coding sequence length (bp)2649
Protein length (aa) 883

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02666 PS_Dcarbxylase Phosphatidylserine decarboxylase 1.6E-58 79 290
PF01764 Lipase_3 Lipase (class 3) 4.0E-06 585 617

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008654 phospholipid biosynthetic process Yes
GO:0004609 phosphatidylserine decarboxylase activity Yes
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0016829 lyase activity No
GO:0044238 primary metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0003674 molecular_function No
GO:0019637 organophosphate metabolic process No
GO:0009987 cellular process No
GO:0016831 carboxy-lyase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016830 carbon-carbon lyase activity No
GO:0044255 cellular lipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0090407 organophosphate biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g10558.t1
MREQQPLWKKLKLLLLFNPLTEWLDTTHLMRLYLHHAAIEEGKEEASPASRNRIKAFVDFYRINMNDFTPSDITA
YATFEDFFVRAHKPGSRPIYRKDDPTAAVIVADSRVVAYEAVAESKKIWIKGNDFSITNLVMDKQLGPKFADGPV
ASFRLSPQDYHRYHSPVSGTIKQFRSMPGDYYEVDPIALQSQVDILTRNARDYVVIETKEFGDVLFVAIGASQVG
TVRIHPQYQQPGNQIQKGDELGIFQFGGSSIIVAFQKGRIQFDEDILKASKNAIAVDVEVGMSLGLRGHNKKSFW
GNTRLSDLLWPVTLLPGLISAYQPVYLGSRQSSPFLPPQIPLGDSPPLSDTHEFTLRHIFHRGTYQDPDLHRRLD
ITPDTRLRAVSDAGIESDVVTPNTPLVASSQPLIIERLADRRLSVIEEHLVTARSSGSAVALSPSDWVMDTLPGP
NVTEKKTVVALAMMTANDYIEVPGTGDWQDIHGRFNHSGSFGWQGDGLRGHVYADKTNSTVVISLKGTSPALFDG
EGTTTNDKINDNLFFSCCCGQGGSYLWRQVCDCQTTLYNANLTCIVEAMLDENRYYRASLDLYSNITEMYPNANV
WLTGHSLGGAVSSLLGLTFGVPVVTFEAVPEALPAARLGLPSPPGHDSRYPQSRRNTGSYHFGHTADPVYMGTCN
GVSSVCTWGGYAMESACHTGQMCVYDTVEDKGWRVGLSKHRINYVIANVLAGYDDVPPCAPEEECYDCELWKFFR
SNGSEITTTTSATSTSTSTTTSRTSTCKTPGWWGCLDQTTTTETTSTSTSTSTCKTPGWFGCKDPTTTSDITSVP
TITTTEPPMTSTTTCKTPGWFGCKDETTTQVIAPAATLTITEPPVTSTTTGKHLGRF*
Coding >Ani_SJS100_1|g10558.t1
ATGCGGGAACAGCAGCCGCTATGGAAGAAGCTCAAGCTGCTTCTCTTGTTCAACCCGTTGACAGAGTGGCTTGAT
ACCACCCATCTGATGCGGTTATACCTGCACCATGCAGCCATTGAGGAAGGCAAAGAAGAAGCCAGCCCTGCATCT
CGGAATCGCATCAAGGCCTTTGTTGACTTCTACCGCATCAATATGAACGATTTCACCCCTTCCGACATAACAGCC
TACGCGACATTCGAAGACTTCTTCGTACGTGCCCACAAGCCTGGCTCGCGCCCCATCTACCGTAAAGACGACCCC
ACAGCTGCAGTGATAGTTGCCGACTCGCGAGTCGTCGCTTACGAAGCCGTAGCCGAGAGCAAGAAAATCTGGATC
AAAGGGAATGATTTTTCTATTACAAATCTGGTAATGGATAAGCAATTGGGGCCGAAGTTCGCGGACGGCCCGGTT
GCGAGTTTTCGGTTGTCGCCGCAGGATTATCATCGGTATCATAGTCCGGTTTCGGGGACTATTAAGCAGTTTCGA
AGCATGCCGGGAGACTATTACGAGGTGGATCCGATAGCGTTGCAGAGTCAGGTGGACATCTTGACGAGGAATGCG
AGAGATTATGTGGTTATCGAGACGAAGGAGTTTGGGGATGTGCTTTTTGTGGCTATTGGGGCTTCGCAGGTGGGA
ACTGTGAGGATTCATCCGCAGTATCAGCAACCGGGGAATCAGATACAAAAGGGTGATGAGCTTGGGATCTTCCAG
TTTGGAGGGTCGTCCATCATTGTCGCATTCCAGAAGGGTCGTATACAGTTCGATGAGGACATACTGAAAGCAAGT
AAGAACGCCATTGCTGTCGATGTTGAAGTGGGGATGAGTCTAGGCCTTCGAGGGCATAATAAGAAGTCTTTTTGG
GGGAACACAAGACTTTCCGACCTGCTATGGCCGGTGACACTACTTCCAGGCCTGATCTCCGCTTATCAGCCCGTA
TACCTCGGATCCCGACAATCATCGCCCTTCCTCCCTCCTCAGATCCCACTGGGCGACTCGCCTCCCCTCTCAGAC
ACCCACGAATTCACGCTTCGCCATATTTTCCACCGAGGAACTTATCAAGATCCCGATCTCCACCGCAGGCTTGAT
ATCACGCCAGACACTCGTCTTCGGGCCGTCTCAGACGCAGGGATCGAATCCGATGTCGTCACACCGAATACTCCG
CTGGTTGCTTCGTCACAACCCCTCATAATCGAAAGACTTGCAGACCGACGCCTCTCGGTCATTGAGGAACATCTT
GTGACTGCGCGATCCTCTGGCTCGGCAGTTGCGCTGTCGCCGTCCGATTGGGTTATGGATACACTGCCTGGCCCA
AATGTCACAGAGAAGAAGACTGTCGTTGCTTTAGCAATGATGACGGCAAATGACTATATCGAGGTACCTGGGACT
GGCGATTGGCAGGATATTCATGGTCGGTTCAACCACTCCGGAAGTTTTGGGTGGCAAGGGGACGGACTCCGTGGT
CACGTATATGCCGATAAGACAAATAGCACTGTTGTCATTTCCCTCAAGGGAACCTCACCGGCCTTGTTCGATGGC
GAAGGCACTACCACAAATGATAAAATCAACGACAATTTATTCTTCAGCTGCTGCTGTGGCCAGGGCGGTTCTTAC
CTCTGGCGGCAAGTCTGCGATTGCCAGACAACTCTGTACAATGCGAACCTGACATGCATCGTTGAGGCGATGCTA
GATGAGAACAGATATTATCGCGCCTCACTCGACCTTTACTCTAACATTACCGAGATGTACCCAAATGCCAACGTT
TGGCTGACCGGCCATTCTTTAGGTGGTGCTGTGTCCAGCTTGCTAGGTCTAACTTTTGGGGTACCAGTCGTCACC
TTTGAAGCTGTTCCGGAAGCACTCCCAGCAGCTCGTTTAGGTCTTCCCAGCCCACCAGGACATGACTCACGTTAC
CCTCAGTCACGAAGGAACACTGGGTCGTATCATTTCGGACATACGGCAGACCCGGTTTACATGGGAACTTGCAAT
GGAGTTAGCTCAGTTTGTACCTGGGGTGGCTATGCCATGGAATCCGCATGCCATACTGGCCAGATGTGTGTCTAT
GACACTGTTGAAGACAAAGGCTGGCGTGTTGGTCTCAGCAAACATCGCATAAACTATGTCATTGCCAATGTTCTT
GCTGGTTACGACGATGTGCCCCCCTGTGCGCCTGAAGAGGAATGCTACGATTGTGAACTCTGGAAATTCTTCCGC
AGTAACGGTTCTGAAATCACTACTACCACCTCGGCCACCTCTACATCCACGTCCACTACGACTAGCAGGACATCC
ACCTGCAAGACTCCTGGATGGTGGGGCTGCTTAGACCAAACCACGACTACCGAGACAACGTCGACCTCCACCTCC
ACCTCCACCTGCAAGACCCCTGGCTGGTTCGGCTGCAAAGATCCAACAACCACATCGGATATTACATCTGTACCA
ACAATCACCACAACTGAACCTCCCATGACCTCGACCACGACCTGCAAGACCCCGGGATGGTTCGGCTGCAAAGAT
GAAACAACCACTCAGGTTATTGCACCTGCAGCAACCCTCACCATAACTGAACCTCCCGTGACCTCGACTACTACC
GGCAAGCACTTGGGCAGGTTTTGA
Transcript >Ani_SJS100_1|g10558.t1
ATGCGGGAACAGCAGCCGCTATGGAAGAAGCTCAAGCTGCTTCTCTTGTTCAACCCGTTGACAGAGTGGCTTGAT
ACCACCCATCTGATGCGGTTATACCTGCACCATGCAGCCATTGAGGAAGGCAAAGAAGAAGCCAGCCCTGCATCT
CGGAATCGCATCAAGGCCTTTGTTGACTTCTACCGCATCAATATGAACGATTTCACCCCTTCCGACATAACAGCC
TACGCGACATTCGAAGACTTCTTCGTACGTGCCCACAAGCCTGGCTCGCGCCCCATCTACCGTAAAGACGACCCC
ACAGCTGCAGTGATAGTTGCCGACTCGCGAGTCGTCGCTTACGAAGCCGTAGCCGAGAGCAAGAAAATCTGGATC
AAAGGGAATGATTTTTCTATTACAAATCTGGTAATGGATAAGCAATTGGGGCCGAAGTTCGCGGACGGCCCGGTT
GCGAGTTTTCGGTTGTCGCCGCAGGATTATCATCGGTATCATAGTCCGGTTTCGGGGACTATTAAGCAGTTTCGA
AGCATGCCGGGAGACTATTACGAGGTGGATCCGATAGCGTTGCAGAGTCAGGTGGACATCTTGACGAGGAATGCG
AGAGATTATGTGGTTATCGAGACGAAGGAGTTTGGGGATGTGCTTTTTGTGGCTATTGGGGCTTCGCAGGTGGGA
ACTGTGAGGATTCATCCGCAGTATCAGCAACCGGGGAATCAGATACAAAAGGGTGATGAGCTTGGGATCTTCCAG
TTTGGAGGGTCGTCCATCATTGTCGCATTCCAGAAGGGTCGTATACAGTTCGATGAGGACATACTGAAAGCAAGT
AAGAACGCCATTGCTGTCGATGTTGAAGTGGGGATGAGTCTAGGCCTTCGAGGGCATAATAAGAAGTCTTTTTGG
GGGAACACAAGACTTTCCGACCTGCTATGGCCGGTGACACTACTTCCAGGCCTGATCTCCGCTTATCAGCCCGTA
TACCTCGGATCCCGACAATCATCGCCCTTCCTCCCTCCTCAGATCCCACTGGGCGACTCGCCTCCCCTCTCAGAC
ACCCACGAATTCACGCTTCGCCATATTTTCCACCGAGGAACTTATCAAGATCCCGATCTCCACCGCAGGCTTGAT
ATCACGCCAGACACTCGTCTTCGGGCCGTCTCAGACGCAGGGATCGAATCCGATGTCGTCACACCGAATACTCCG
CTGGTTGCTTCGTCACAACCCCTCATAATCGAAAGACTTGCAGACCGACGCCTCTCGGTCATTGAGGAACATCTT
GTGACTGCGCGATCCTCTGGCTCGGCAGTTGCGCTGTCGCCGTCCGATTGGGTTATGGATACACTGCCTGGCCCA
AATGTCACAGAGAAGAAGACTGTCGTTGCTTTAGCAATGATGACGGCAAATGACTATATCGAGGTACCTGGGACT
GGCGATTGGCAGGATATTCATGGTCGGTTCAACCACTCCGGAAGTTTTGGGTGGCAAGGGGACGGACTCCGTGGT
CACGTATATGCCGATAAGACAAATAGCACTGTTGTCATTTCCCTCAAGGGAACCTCACCGGCCTTGTTCGATGGC
GAAGGCACTACCACAAATGATAAAATCAACGACAATTTATTCTTCAGCTGCTGCTGTGGCCAGGGCGGTTCTTAC
CTCTGGCGGCAAGTCTGCGATTGCCAGACAACTCTGTACAATGCGAACCTGACATGCATCGTTGAGGCGATGCTA
GATGAGAACAGATATTATCGCGCCTCACTCGACCTTTACTCTAACATTACCGAGATGTACCCAAATGCCAACGTT
TGGCTGACCGGCCATTCTTTAGGTGGTGCTGTGTCCAGCTTGCTAGGTCTAACTTTTGGGGTACCAGTCGTCACC
TTTGAAGCTGTTCCGGAAGCACTCCCAGCAGCTCGTTTAGGTCTTCCCAGCCCACCAGGACATGACTCACGTTAC
CCTCAGTCACGAAGGAACACTGGGTCGTATCATTTCGGACATACGGCAGACCCGGTTTACATGGGAACTTGCAAT
GGAGTTAGCTCAGTTTGTACCTGGGGTGGCTATGCCATGGAATCCGCATGCCATACTGGCCAGATGTGTGTCTAT
GACACTGTTGAAGACAAAGGCTGGCGTGTTGGTCTCAGCAAACATCGCATAAACTATGTCATTGCCAATGTTCTT
GCTGGTTACGACGATGTGCCCCCCTGTGCGCCTGAAGAGGAATGCTACGATTGTGAACTCTGGAAATTCTTCCGC
AGTAACGGTTCTGAAATCACTACTACCACCTCGGCCACCTCTACATCCACGTCCACTACGACTAGCAGGACATCC
ACCTGCAAGACTCCTGGATGGTGGGGCTGCTTAGACCAAACCACGACTACCGAGACAACGTCGACCTCCACCTCC
ACCTCCACCTGCAAGACCCCTGGCTGGTTCGGCTGCAAAGATCCAACAACCACATCGGATATTACATCTGTACCA
ACAATCACCACAACTGAACCTCCCATGACCTCGACCACGACCTGCAAGACCCCGGGATGGTTCGGCTGCAAAGAT
GAAACAACCACTCAGGTTATTGCACCTGCAGCAACCCTCACCATAACTGAACCTCCCGTGACCTCGACTACTACC
GGCAAGCACTTGGGCAGGTTTTGA
Gene >Ani_SJS100_1|g10558.t1
ATGCGGGAACAGCAGCCGCTATGGAAGAAGCTCAAGCTGCTTCTCTTGTTCAACCCGTTGACAGAGTGGCTTGAT
ACCACCCATCTGATGCGGTTATACCTGCACCATGCAGCCATTGAGGAAGGTAGCATAATCACTTCCCTTTCTATA
TTTCTCTTTTTCCCCAGACTCAGTGTTGACCCCAACAGGCAAAGAAGAAGCCAGCCCTGCATCTCGGAATCGCAT
CAAGGCCTTTGTTGACTTCTACCGCATCAATATGAACGATTTCACCCCTTCCGACATAACAGCCTACGCGACATT
CGAAGACTTCTTCGTACGTGCCCACAAGCCTGGCTCGCGCCCCATCTACCGTAAAGACGACCCCACAGCTGCAGT
GATAGTTGCCGACTCGCGAGTCGTCGCTTACGAAGCCGTAGCCGAGAGCAAGAAAATCTGGATCAAAGGGAATGA
TTTTTCTATTACAAATCTGGTAATGGATAAGCAATTGGGGCCGAAGTTCGCGGACGGCCCGGTTGCGAGTTTTCG
GTTGTCGCCGCAGGATTATCATCGGTATCATAGTCCGGTTTCGGGGACTATTAAGCAGTTTCGAAGCATGCCGGG
AGACTATTACGAGGTGGATCCGATAGCGTTGCAGAGTCAGGTGGACATCTTGACGAGGAATGCGAGAGATTATGT
GGTTATCGAGACGAAGGAGTTTGGGGATGTGCTTTTTGTGGCTATTGGGGCTTCGCAGGTGGGAACTGTGAGGTA
TGCAGTTCATGAGTATGGTTGGCAGTTGAAGAGTGCTAATGTTTAGTAGGATTCATCCGCAGTATCAGCAACCGG
GGAATCAGATACAAAAGGGTGATGAGCTTGGGATCTTCCAGTTTGGAGGGTCGTCCATCATTGTCGCATTCCAGA
AGGGTCGTATACAGTTCGATGAGGACATACTGAAAGCAAGTAAGAACGCCATTGCTGTCGATGTTGAAGTGGGGA
TGAGTCTAGGTCGGGCTGTGGGTGAAAAGGTACATGATGAGTTATAGCATCAGCAAGTAGGTAGTGGATGCCATG
CTGGAGACAAGTCAGTGCTGGTGTTAGGCTTTGTTCTGGTTTTGTTCAAGGATAGAAGAGTATGTGGTCGAATCG
GGAAAGGGTGGGTATGTTGTGAGAAACAAAAAATGAGAGGTTATGCCAGAGAGACGAGCATTGATGTGACGCTTG
TGGAAGATGGCGTGGTCGGGGCGGTTCTGTGGGCAAGCTAGGGGGACTAGTTATAGTGGGACGTCAAAACATCCC
TCATAATGGAATACTGTAACAACATAAGTATGGGATGATCCTTGGATATTGTAATCCAGCACACTCTGCAGTGGG
TTCCTGGGGTGCGCTAAGTAACTAATAATCTCAGCCGGGTTTAGTCCTTCACAGGCTCTTTTCTCCGCAGTAGCT
GAACACTTCAACAACCTGTCATGTACAAAGCGGGTGCCACCAGTAACCTAGGGGTTCCTGGCATTGAAAAACATG
TTTTTGGAGAAGGAACAGTTTATGTGAAGTTGTATGCGGTTTATACCTTTCCAGATGGAGTGTTTGTTTGTGTTG
TCCATCTGTTGCATTCCACCTTGCGGGCCACTGCCGAGGTCCTAGTAGCATTCACGTGACCGCGTATCCACTTGC
CAGCCCAGTCGGTGGCCACCTCGACTACTGCTATCTATCTACAGGATGGACCCGTTTATCTAAAGCGACCCTGTT
GCCATCGTTCTTAGCTCTCAGCATCATCCCTGCATCTTTGACCATCACTGTATCGCCATGAAAGGCCTTCGAGGG
CATAATAAGAAGTCTTTTTGGGGGAACACAAGACTTTCCGACCTGCTATGGCCGGTGACACTACTTCCAGGCCTG
ATCTCCGCTTATCAGCCCGTATACCTCGGATCCCGACAATCATCGCCCTTCCTCCCTCCTCAGATCCCACTGGGC
GACTCGCCTCCCCTCTCAGACACCCACGAATTCACGCTTCGCCATATTTTCCACCGAGGAACTTATCAAGATCCC
GATCTCCACCGCAGGCTTGATATCACGCCAGACACTCGTCTTCGGGCCGTCTCAGACGCAGGGATCGAATCCGAT
GTCGTCACACCGAATACTCCGCTGGTTGCTTCGTCACAACCCCTCATAATCGAAAGACTTGCAGACCGACGCCTC
TCGGTCATTGAGGAACATCTTGTGACTGCGCGATCCTCTGGCTCGGCAGTTGCGCTGTCGCCGTCCGATTGGGTT
ATGGATACACTGCCTGGCCCAAATGTCACAGAGAAGAAGACTGTCGTTGCTTTAGCAATGATGACGGCAAATGAC
TATATCGAGGTACCTGGGACTGGCGATTGGCAGGATATTCATGGTCGGTTCAACCACTCCGGAAGTTTTGGGTGG
CAAGGGGACGGACTCCGTGGTCACGTATATGCCGATAAGACAAATAGCACTGTTGTCATTTCCCTCAAGGGAACC
TCACCGGCCTTGTTCGATGGCGAAGGCACTACCACAAATGATAAAATCAACGACAATTTATTCTTCAGCTGCTGC
TGTGGCCAGGGCGGTTCTTACCTCTGGCGGCAAGTCTGCGATTGCCAGACAACTCTGTACAATGCGAACCTGACA
TGCATCGTTGAGGCGATGCTAGATGAGAACAGATATTATCGCGCCTCACTCGACCTTTACTCTAACATTACCGAG
ATGTACCCAAATGCCAACGTTTGGCTGACCGGCCATTCTTTAGGTGGTGCTGTGTCCAGCTTGCTAGGTCTAACT
TTTGGGGTACCAGTCGTCACCTTTGAAGCTGTTCCGGAAGCACTCCCAGCAGCTCGTTTAGGTCTTCCCAGCCCA
CCAGGACATGACTCACGTTACCCTCAGTCACGAAGGAACACTGGGTCGTATCATTTCGGACATACGGCAGACCCG
GTTTACATGGGAACTTGCAATGGAGTTAGCTCAGTTTGTACCTGGGGTGGCTATGCCATGGAATCCGCATGCCAT
ACTGGCCAGATGTGTGTCTATGACACTGTTGAAGACAAAGGCTGGCGTGTTGGTCTCAGCAAACATCGCATAAAC
TATGTCATTGCCAATGTTCTTGCTGGTTACGACGATGTGCCCCCCTGTGCGCCTGAAGAGGAATGCTACGATTGT
GAACTCTGGAAATTCTTCCGCAGTAACGGTTCTGAAATCACTACTACCACCTCGGCCACCTCTACATCCACGTCC
ACTACGACTAGCAGGACATCCACCTGCAAGACTCCTGGATGGTGGGGCTGCTTAGACCAAACCACGACTACCGAG
ACAACGTCGACCTCCACCTCCACCTCCACCTGCAAGACCCCTGGCTGGTTCGGCTGCAAAGATCCAACAACCACA
TCGGATATTACATCTGTACCAACAATCACCACAACTGAACCTCCCATGACCTCGACCACGACCTGCAAGACCCCG
GGATGGTTCGGCTGCAAAGATGAAACAACCACTCAGGTTATTGCACCTGCAGCAACCCTCACCATAACTGAACCT
CCCGTGACCTCGACTACTACCGGCAAGCACTTGGGCAGGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail