Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g10432.t1
Gene name
Locationscaffold_116:63799..66803
Strand+
Gene length (bp)3004
Transcript length (bp)2880
Coding sequence length (bp)2880
Protein length (aa) 960

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.9E-53 59 458
PF00975 Thioesterase Thioesterase domain 8.4E-28 688 800
PF00550 PP-binding Phosphopantetheine attachment site 1.9E-11 597 662

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g10432.t1
MAPHVIEGNGQAIEPTSKSIAAKDVPVTTLESPSTVQNLAQLLAKAAASTAGLTFYTPGAEVSCVSYAELQSRAT
EKARLLSRIDGISASSIILLHFENHHDTILWFWAATLTGLLPAISTPFVHDPAQRMKHLRHLKTLLQEPVVLTTE
RLVPDFLDTDELRVLPVEVLDKAANSDGLADRLPLCGAEKQAQDPAVLMLTSGSTGSAKAVPLRHGQLLTALQGK
KEHHGTEPGDVFLTWVGLDHVASLLSLGADQVLIPASELLRDPIRFIQLLDSHSVAYTFAPNFFLTQVRDALAAN
PSLQADLSHLKSINSGGEANVVATIDGLTRELRRFAIQREVISPGFGMTETCAGCVHARASPSYDLSKGLEFACL
GPCTPGIKMRVMGPRAKDEPAAPGEVGELQLSGPAVFTGYFNNPEATAAAFTEDGWFITGDLAWLDDSGYLNLAG
RTRDTIIVNGVKWSATEIEVTIEEENIPGVVPSYTVAFPCRAPGSASEDIAVVYSPAYAADDAAARFETATAIAK
TVALLTGRKPAHLIPLPAEMLDKSSLGKISRTKVRTGFEKGEYAPFEEEDLKIVQKYRESTQRSAQTETEKRVQN
TIAGLLKIPIEDINVDMSIFDLGITSFNLILLKAMIQEAVDAPLEIPMSVLMTNPTTSAISASIDKLLSQPPTYN
PIVPLQPHGTKIPLFLIHPGSGDILVFIALAAQFPTRPVYALRTRGYNTNERFFHSIQETADTYAHYIRQTQPEG
PYAIAGYSLGSTLAFEVGKVLESQGQEVRFLASIDYPPHIRQYVRGQNWIDVLLHIAFFLELIDLEVMGEAGVYL
HSLEKDKGGEGVSRYDALVHVLNISDKERVRALALNPERLERITDIGENFRVHGETYEPQGTVETLDVFVADPPS
YAALNRQDWEENKLGAWREFARTEVGFYNCPGIHATMLNPVHVPEFVRGFKLAMKRRGV*
Coding >Ani_SJS100_1|g10432.t1
ATGGCTCCTCACGTTATCGAGGGCAATGGCCAGGCAATTGAGCCAACATCCAAGTCAATTGCTGCGAAGGATGTC
CCAGTGACCACTCTCGAGTCTCCAAGCACAGTACAGAACCTAGCTCAGCTCCTAGCCAAAGCAGCCGCTTCTACA
GCCGGGCTCACCTTCTACACCCCGGGAGCAGAAGTCTCCTGTGTTTCGTACGCCGAGCTTCAGAGCAGAGCCACG
GAGAAAGCTCGGCTCTTGAGTCGAATCGATGGCATCTCCGCGTCTTCCATCATTCTCCTGCACTTTGAGAACCAT
CATGACACGATTCTATGGTTCTGGGCTGCCACATTGACAGGCTTGCTTCCTGCCATTTCAACCCCATTCGTGCAT
GATCCCGCGCAGCGCATGAAGCATCTGCGTCATCTTAAGACTCTTCTGCAGGAACCCGTCGTCCTCACCACAGAG
CGGCTTGTCCCGGATTTCCTGGACACGGATGAGCTTCGTGTGCTTCCGGTCGAGGTACTAGACAAGGCTGCTAAT
TCGGATGGTCTAGCTGACCGTCTGCCACTCTGCGGAGCTGAGAAGCAAGCACAAGACCCAGCGGTTCTCATGCTG
ACGTCTGGAAGTACTGGGAGCGCCAAGGCAGTTCCACTCCGCCATGGCCAGCTTCTCACGGCATTGCAAGGCAAG
AAAGAACACCATGGAACTGAGCCCGGTGATGTATTTCTCACCTGGGTTGGATTGGACCATGTTGCTAGTCTTTTG
AGTCTGGGCGCCGACCAAGTGCTCATTCCAGCCTCAGAGCTGCTGCGCGATCCAATACGCTTTATCCAGCTGCTC
GACTCCCACAGTGTTGCCTACACATTTGCGCCAAACTTCTTCTTGACGCAGGTGCGGGATGCTCTTGCCGCCAAC
CCATCCCTCCAAGCGGATTTGTCTCATCTCAAAAGCATAAACTCTGGCGGCGAGGCCAACGTCGTCGCCACTATT
GATGGATTGACTCGAGAACTGCGTCGCTTTGCCATCCAGCGCGAGGTGATAAGTCCTGGCTTTGGTATGACAGAG
ACATGTGCCGGATGCGTTCACGCGCGGGCATCACCGTCCTACGATCTATCCAAGGGCCTCGAGTTCGCTTGTCTC
GGACCATGTACTCCCGGCATCAAGATGCGCGTGATGGGCCCCAGGGCTAAAGATGAACCCGCTGCGCCTGGTGAA
GTTGGCGAGCTTCAGCTGTCCGGTCCTGCTGTGTTCACCGGATACTTTAACAACCCGGAGGCCACAGCTGCCGCG
TTCACGGAGGACGGGTGGTTCATCACGGGCGATCTCGCCTGGCTAGATGACTCGGGGTATCTGAACCTGGCGGGA
CGGACTAGAGACACTATTATCGTTAACGGAGTCAAATGGAGTGCCACGGAGATTGAAGTGACTATCGAAGAAGAG
AACATCCCTGGGGTCGTGCCCTCGTATACCGTGGCCTTTCCTTGCCGTGCTCCGGGCTCTGCTAGCGAGGATATT
GCTGTTGTCTACTCCCCTGCCTATGCTGCTGACGACGCCGCGGCGCGTTTCGAGACTGCCACGGCCATCGCAAAG
ACCGTCGCACTCCTAACGGGGCGAAAACCTGCCCATTTGATTCCGCTGCCGGCGGAGATGCTGGACAAGTCCTCA
CTGGGGAAGATTTCGCGGACCAAGGTGCGGACCGGCTTCGAAAAGGGAGAGTATGCACCTTTCGAGGAGGAAGAC
CTCAAGATTGTCCAGAAATATCGCGAGTCCACGCAGCGATCCGCCCAAACCGAGACCGAGAAACGAGTGCAAAAC
ACTATAGCAGGACTACTCAAGATCCCCATCGAAGACATCAACGTGGACATGTCAATCTTCGATCTCGGAATCACC
TCGTTCAACCTGATTCTCCTCAAAGCGATGATTCAAGAAGCCGTCGACGCACCCCTAGAGATTCCCATGTCTGTT
CTGATGACCAATCCCACAACATCCGCCATCTCCGCCTCCATCGACAAACTCCTCTCCCAACCGCCAACCTACAAC
CCCATCGTGCCGCTGCAACCCCACGGCACCAAAATCCCCCTCTTCCTCATCCACCCCGGCAGCGGAGACATTCTC
GTCTTCATCGCTTTAGCAGCCCAATTCCCCACCCGACCCGTCTACGCCCTCCGCACCCGCGGCTACAACACCAAC
GAACGCTTCTTCCACTCCATCCAAGAAACCGCCGACACCTACGCCCACTACATCCGGCAGACCCAGCCTGAAGGC
CCCTACGCCATAGCAGGCTACTCGCTTGGCTCGACTCTCGCCTTCGAAGTGGGCAAAGTGCTCGAATCCCAGGGC
CAAGAAGTCCGTTTCTTAGCAAGTATCGACTACCCGCCGCATATCCGGCAGTACGTGCGCGGACAGAACTGGATT
GATGTGTTGCTTCATATAGCCTTCTTCCTGGAGCTTATTGATTTAGAAGTGATGGGTGAGGCTGGAGTCTACCTC
CATAGTCTGGAAAAAGACAAAGGAGGGGAGGGGGTATCTCGCTACGATGCCCTCGTTCACGTTCTAAATATCTCT
GATAAGGAGAGAGTGCGTGCACTAGCTCTCAATCCCGAGAGATTAGAACGGATCACGGACATCGGAGAGAACTTC
CGGGTCCATGGCGAGACGTATGAGCCGCAGGGAACAGTGGAGACATTAGATGTATTTGTGGCGGATCCGCCGAGT
TACGCGGCATTGAATAGACAAGATTGGGAGGAGAATAAGCTAGGGGCGTGGAGGGAGTTTGCACGCACTGAAGTC
GGGTTTTACAATTGTCCCGGGATTCATGCTACCATGTTGAATCCGGTGCATGTGCCGGAGTTTGTGAGGGGGTTT
AAGTTGGCGATGAAGAGAAGGGGGGTTTAG
Transcript >Ani_SJS100_1|g10432.t1
ATGGCTCCTCACGTTATCGAGGGCAATGGCCAGGCAATTGAGCCAACATCCAAGTCAATTGCTGCGAAGGATGTC
CCAGTGACCACTCTCGAGTCTCCAAGCACAGTACAGAACCTAGCTCAGCTCCTAGCCAAAGCAGCCGCTTCTACA
GCCGGGCTCACCTTCTACACCCCGGGAGCAGAAGTCTCCTGTGTTTCGTACGCCGAGCTTCAGAGCAGAGCCACG
GAGAAAGCTCGGCTCTTGAGTCGAATCGATGGCATCTCCGCGTCTTCCATCATTCTCCTGCACTTTGAGAACCAT
CATGACACGATTCTATGGTTCTGGGCTGCCACATTGACAGGCTTGCTTCCTGCCATTTCAACCCCATTCGTGCAT
GATCCCGCGCAGCGCATGAAGCATCTGCGTCATCTTAAGACTCTTCTGCAGGAACCCGTCGTCCTCACCACAGAG
CGGCTTGTCCCGGATTTCCTGGACACGGATGAGCTTCGTGTGCTTCCGGTCGAGGTACTAGACAAGGCTGCTAAT
TCGGATGGTCTAGCTGACCGTCTGCCACTCTGCGGAGCTGAGAAGCAAGCACAAGACCCAGCGGTTCTCATGCTG
ACGTCTGGAAGTACTGGGAGCGCCAAGGCAGTTCCACTCCGCCATGGCCAGCTTCTCACGGCATTGCAAGGCAAG
AAAGAACACCATGGAACTGAGCCCGGTGATGTATTTCTCACCTGGGTTGGATTGGACCATGTTGCTAGTCTTTTG
AGTCTGGGCGCCGACCAAGTGCTCATTCCAGCCTCAGAGCTGCTGCGCGATCCAATACGCTTTATCCAGCTGCTC
GACTCCCACAGTGTTGCCTACACATTTGCGCCAAACTTCTTCTTGACGCAGGTGCGGGATGCTCTTGCCGCCAAC
CCATCCCTCCAAGCGGATTTGTCTCATCTCAAAAGCATAAACTCTGGCGGCGAGGCCAACGTCGTCGCCACTATT
GATGGATTGACTCGAGAACTGCGTCGCTTTGCCATCCAGCGCGAGGTGATAAGTCCTGGCTTTGGTATGACAGAG
ACATGTGCCGGATGCGTTCACGCGCGGGCATCACCGTCCTACGATCTATCCAAGGGCCTCGAGTTCGCTTGTCTC
GGACCATGTACTCCCGGCATCAAGATGCGCGTGATGGGCCCCAGGGCTAAAGATGAACCCGCTGCGCCTGGTGAA
GTTGGCGAGCTTCAGCTGTCCGGTCCTGCTGTGTTCACCGGATACTTTAACAACCCGGAGGCCACAGCTGCCGCG
TTCACGGAGGACGGGTGGTTCATCACGGGCGATCTCGCCTGGCTAGATGACTCGGGGTATCTGAACCTGGCGGGA
CGGACTAGAGACACTATTATCGTTAACGGAGTCAAATGGAGTGCCACGGAGATTGAAGTGACTATCGAAGAAGAG
AACATCCCTGGGGTCGTGCCCTCGTATACCGTGGCCTTTCCTTGCCGTGCTCCGGGCTCTGCTAGCGAGGATATT
GCTGTTGTCTACTCCCCTGCCTATGCTGCTGACGACGCCGCGGCGCGTTTCGAGACTGCCACGGCCATCGCAAAG
ACCGTCGCACTCCTAACGGGGCGAAAACCTGCCCATTTGATTCCGCTGCCGGCGGAGATGCTGGACAAGTCCTCA
CTGGGGAAGATTTCGCGGACCAAGGTGCGGACCGGCTTCGAAAAGGGAGAGTATGCACCTTTCGAGGAGGAAGAC
CTCAAGATTGTCCAGAAATATCGCGAGTCCACGCAGCGATCCGCCCAAACCGAGACCGAGAAACGAGTGCAAAAC
ACTATAGCAGGACTACTCAAGATCCCCATCGAAGACATCAACGTGGACATGTCAATCTTCGATCTCGGAATCACC
TCGTTCAACCTGATTCTCCTCAAAGCGATGATTCAAGAAGCCGTCGACGCACCCCTAGAGATTCCCATGTCTGTT
CTGATGACCAATCCCACAACATCCGCCATCTCCGCCTCCATCGACAAACTCCTCTCCCAACCGCCAACCTACAAC
CCCATCGTGCCGCTGCAACCCCACGGCACCAAAATCCCCCTCTTCCTCATCCACCCCGGCAGCGGAGACATTCTC
GTCTTCATCGCTTTAGCAGCCCAATTCCCCACCCGACCCGTCTACGCCCTCCGCACCCGCGGCTACAACACCAAC
GAACGCTTCTTCCACTCCATCCAAGAAACCGCCGACACCTACGCCCACTACATCCGGCAGACCCAGCCTGAAGGC
CCCTACGCCATAGCAGGCTACTCGCTTGGCTCGACTCTCGCCTTCGAAGTGGGCAAAGTGCTCGAATCCCAGGGC
CAAGAAGTCCGTTTCTTAGCAAGTATCGACTACCCGCCGCATATCCGGCAGTACGTGCGCGGACAGAACTGGATT
GATGTGTTGCTTCATATAGCCTTCTTCCTGGAGCTTATTGATTTAGAAGTGATGGGTGAGGCTGGAGTCTACCTC
CATAGTCTGGAAAAAGACAAAGGAGGGGAGGGGGTATCTCGCTACGATGCCCTCGTTCACGTTCTAAATATCTCT
GATAAGGAGAGAGTGCGTGCACTAGCTCTCAATCCCGAGAGATTAGAACGGATCACGGACATCGGAGAGAACTTC
CGGGTCCATGGCGAGACGTATGAGCCGCAGGGAACAGTGGAGACATTAGATGTATTTGTGGCGGATCCGCCGAGT
TACGCGGCATTGAATAGACAAGATTGGGAGGAGAATAAGCTAGGGGCGTGGAGGGAGTTTGCACGCACTGAAGTC
GGGTTTTACAATTGTCCCGGGATTCATGCTACCATGTTGAATCCGGTGCATGTGCCGGAGTTTGTGAGGGGGTTT
AAGTTGGCGATGAAGAGAAGGGGGGTTTAG
Gene >Ani_SJS100_1|g10432.t1
ATGGCTCCTCACGTTATCGAGGGCAATGGCCAGGCAATTGAGCCAACATCCAAGTCAATTGCTGCGAAGGATGTC
CCAGTGACCACTCTCGAGTCTCCAAGCACAGTACAGAACCTAGCTCAGCTCCTAGCCAAAGCAGCCGCTTCTACA
GCCGGGCTCACCTTCTACACCCCGGGAGCAGAAGTCTCCTGTGTTTCGTACGCCGAGCTTCAGAGCAGAGCCACG
GAGAAAGCTCGGCTCTTGAGTCGAATCGATGGCATCTCCGCGTCTTCCATCATTCTCCTGCACTTTGAGAACCAT
CATGACACGATTCTATGGTTCTGGGCTGCCACATTGACAGGCTTGCTTCCTGCCATTTCAACCCCATTCGTGCAT
GATCCCGCGCAGCGCATGAAGCATCTGCGTCATCTTAAGACTCTTCTGCAGGAACCCGTCGTCCTCACCACAGAG
CGGCTTGTCCCGGATTTCCTGGACACGGATGAGCTTCGTGTGCTTCCGGTCGAGGTACTAGACAAGGCTGCTAAT
TCGGATGGTCTAGCTGACCGTCTGCCACTCTGCGGAGCTGAGAAGCAAGCACAAGACCCAGCGGTTCTCATGCTG
ACGTCTGGAAGTACTGGGAGCGCCAAGGCAGTTCCACTCCGCCATGGCCAGCTTCTCACGGCATTGCAAGGCAAG
AAAGAACACCATGGAACTGAGCCCGGTGATGTATTTCTCACCTGGGTTGGATTGGACCATGTTGCTAGTCTTTGT
GAGATTCATCTGCATGCAAGTCCGTGATCATTCTCCTTCTATGAGATTACACCCACTAACAAATCCACAGTGAGT
CTGGGCGCCGACCAAGTGCTCATTCCAGCCTCAGAGCTGCTGCGCGATCCAATACGCTTTATCCAGCTGCTCGAC
TCCCACAGTGTTGCCTACACATTTGCGCCAAACTTCTTCTTGACGCAGGTGCGGGATGCTCTTGCCGCCAACCCA
TCCCTCCAAGCGGATTTGTCTCATCTCAAAAGCATAAACTCTGGCGGCGAGGCCAACGTCGTCGCCACTATTGAT
GGATTGACTCGAGAACTGCGTCGCTTTGCCATCCAGCGCGAGGTGATAAGTCCTGGCTTTGGTATGACAGAGACA
TGTGCCGGATGCGTTCACGCGCGGGCATCACCGTCCTACGATCTATCCAAGGGCCTCGAGTTCGCTTGTCTCGGA
CCATGTACTCCCGGCATCAAGATGCGCGTGATGGGCCCCAGGGCTAAAGATGAACCCGCTGCGCCTGGTGAAGTT
GGCGAGCTTCAGCTGTCCGGTCCTGCTGTGTTCACCGGATACTTTAACAACCCGGAGGCCACAGCTGCCGCGTTC
ACGGAGGACGGGTGGTTCATCACGGGCGATCTCGCCTGGCTAGATGACTCGGGGTATCTGAACCTGGCGGGACGG
ACTAGAGACACTATTATCGTTAACGGAGTCAAATGGAGTGCCACGGAGATTGAAGTGACTATCGAAGAAGAGAAC
ATCCCTGGGGTCGTGCCCTCGTATACCGTGGCCTTTCCTTGCCGTGCTCCGGGCTCTGCTAGCGAGGATATTGCT
GTTGTCTACTCCCCTGCCTATGCTGCTGACGACGCCGCGGCGCGTTTCGAGACTGCCACGGCCATCGCAAAGACC
GTCGCACTCCTAACGGGGCGAAAACCTGCCCATTTGATTCCGCTGCCGGCGGAGATGCTGGACAAGTCCTCACTG
GGGAAGATTTCGCGGACCAAGGTGCGGACCGGCTTCGAAAAGGGAGAGTATGCACCTTTCGAGGAGGAAGACCTC
AAGATTGTCCAGAAATATCGCGAGTCCACGCAGCGATCCGCCCAAACCGAGACCGAGAAACGAGTGCAAAACACT
ATAGCAGGACTACTCAAGATCCCCATCGAAGACATCAACGTGGACATGTCAATCTTCGATCTCGGAATCACCTCG
TTCAACCTGATTCTCCTCAAAGCGATGATTCAAGAAGCCGTCGACGCACCCCTAGAGATTCCCATGTCTGTTCTG
ATGACCAAGTAAGCCCCCTCCCTATACTCCTAATCATCCACACTAACCAGCAACACGCAGTCCCACAACATCCGC
CATCTCCGCCTCCATCGACAAACTCCTCTCCCAACCGCCAACCTACAACCCCATCGTGCCGCTGCAACCCCACGG
CACCAAAATCCCCCTCTTCCTCATCCACCCCGGCAGCGGAGACATTCTCGTCTTCATCGCTTTAGCAGCCCAATT
CCCCACCCGACCCGTCTACGCCCTCCGCACCCGCGGCTACAACACCAACGAACGCTTCTTCCACTCCATCCAAGA
AACCGCCGACACCTACGCCCACTACATCCGGCAGACCCAGCCTGAAGGCCCCTACGCCATAGCAGGCTACTCGCT
TGGCTCGACTCTCGCCTTCGAAGTGGGCAAAGTGCTCGAATCCCAGGGCCAAGAAGTCCGTTTCTTAGCAAGTAT
CGACTACCCGCCGCATATCCGGCAGTACGTGCGCGGACAGAACTGGATTGATGTGTTGCTTCATATAGCCTTCTT
CCTGGAGCTTATTGATTTAGAAGTGATGGGTGAGGCTGGAGTCTACCTCCATAGTCTGGAAAAAGACAAAGGAGG
GGAGGGGGTATCTCGCTACGATGCCCTCGTTCACGTTCTAAATATCTCTGATAAGGAGAGAGTGCGTGCACTAGC
TCTCAATCCCGAGAGATTAGAACGGATCACGGACATCGGAGAGAACTTCCGGGTCCATGGCGAGACGTATGAGCC
GCAGGGAACAGTGGAGACATTAGATGTATTTGTGGCGGATCCGCCGAGTTACGCGGCATTGAATAGACAAGATTG
GGAGGAGAATAAGCTAGGGGCGTGGAGGGAGTTTGCACGCACTGAAGTCGGGTTTTACAATTGTCCCGGGATTCA
TGCTACCATGTTGAATCCGGTGCATGTGCCGGAGTTTGTGAGGGGGTTTAAGTTGGCGATGAAGAGAAGGGGGGT
TTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail