Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g10345.t1
Gene name
Locationscaffold_113:78065..78750
Strand-
Gene length (bp)685
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03928 HbpS-like Haem degrading protein HbpS-like 7.8E-28 30 186

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g10345.t1
MAPQEPVSSHNPADPALVLAQEQALVFPSFTTTTAWTLGVALRSHILALPAHKRRPAVISICLSGSSAPQLVFHC
ATEPGTRVDHVLWLKRKTKTVLRWQVSTWYLHCRLKPTRANESVCVGPSVMEGIEVLAEQFALSPVERYEYALQA
GGFPIRVEGVEGVVGVIAVSGLQEEAADHEVIVAAIREFLDGKKEDSGANAS*
Coding >Ani_SJS100_1|g10345.t1
ATGGCCCCCCAAGAGCCTGTTTCATCGCATAACCCGGCTGACCCCGCCCTTGTTTTGGCCCAAGAACAAGCCTTG
GTCTTTCCCAGCTTTACGACAACCACGGCATGGACACTTGGGGTGGCGCTACGATCCCACATACTGGCTTTGCCC
GCCCACAAGAGACGACCAGCCGTGATCTCGATCTGCCTGTCTGGCTCATCAGCTCCGCAGTTAGTTTTCCACTGT
GCTACAGAGCCGGGAACCCGAGTGGACCATGTTCTTTGGCTTAAGCGCAAGACGAAGACAGTCCTCCGCTGGCAG
GTGTCTACCTGGTACCTCCACTGCCGGTTGAAGCCAACTCGTGCAAATGAGTCCGTGTGTGTCGGGCCTTCAGTT
ATGGAGGGGATAGAGGTGTTGGCTGAGCAGTTTGCTCTGTCACCGGTGGAACGATACGAGTATGCCTTGCAGGCG
GGTGGGTTTCCGATTCGCGTGGAGGGAGTCGAAGGGGTCGTGGGGGTAATTGCTGTGAGTGGGCTGCAGGAGGAG
GCTGCCGACCACGAGGTCATTGTTGCTGCTATACGGGAATTCCTAGATGGAAAAAAAGAAGACAGTGGTGCGAAT
GCTTCCTAA
Transcript >Ani_SJS100_1|g10345.t1
ATGGCCCCCCAAGAGCCTGTTTCATCGCATAACCCGGCTGACCCCGCCCTTGTTTTGGCCCAAGAACAAGCCTTG
GTCTTTCCCAGCTTTACGACAACCACGGCATGGACACTTGGGGTGGCGCTACGATCCCACATACTGGCTTTGCCC
GCCCACAAGAGACGACCAGCCGTGATCTCGATCTGCCTGTCTGGCTCATCAGCTCCGCAGTTAGTTTTCCACTGT
GCTACAGAGCCGGGAACCCGAGTGGACCATGTTCTTTGGCTTAAGCGCAAGACGAAGACAGTCCTCCGCTGGCAG
GTGTCTACCTGGTACCTCCACTGCCGGTTGAAGCCAACTCGTGCAAATGAGTCCGTGTGTGTCGGGCCTTCAGTT
ATGGAGGGGATAGAGGTGTTGGCTGAGCAGTTTGCTCTGTCACCGGTGGAACGATACGAGTATGCCTTGCAGGCG
GGTGGGTTTCCGATTCGCGTGGAGGGAGTCGAAGGGGTCGTGGGGGTAATTGCTGTGAGTGGGCTGCAGGAGGAG
GCTGCCGACCACGAGGTCATTGTTGCTGCTATACGGGAATTCCTAGATGGAAAAAAAGAAGACAGTGGTGCGAAT
GCTTCCTAA
Gene >Ani_SJS100_1|g10345.t1
ATGGCCCCCCAAGAGCCTGTTTCATCGCATAACCCGGCTGACGTGAGAAAATCAATCTTCCTTGCCCACACCCCG
CCGACAATATGATAACTTCTGGCTAATCAGCTAGATGGGATAGCCCGCCCTTGTTTTGGCCCAAGAACAAGCCTT
GGTCTTTCCCAGCTTTACGACAACCACGGCATGGACACTTGGGGTGGCGCTACGATCCCACATACTGGCTTTGCC
CGCCCACAAGAGACGACCAGCCGTGATCTCGATCTGCCTGTCTGGCTCATCAGCTCCGCAGTTAGTTTTCCACTG
TGCTACAGAGCCGGGAACCCGAGTGGACCATGTTCTTTGGCTTAAGCGCAAGACGAAGACAGTCCTCCGCTGGCA
GGTGTCTACCTGGTACCTCCACTGCCGGTTGAAGCCAACTCGTGCAAATGAGTCCGTGTGTGTCGGGCCTTCAGT
TATGGAGGGGATAGAGGTGTTGGCTGAGCAGTTTGCTCTGTCACCGGTGGAACGATACGAGTATGCCTTGCAGGC
GGGTGGGTTTCCGATTCGCGTGGAGGGAGTCGAAGGGGTCGTGGGGGTAATTGCTGTGAGTGGGCTGCAGGAGGA
GGCTGCCGACCACGAGGTCATTGTTGCTGCTATACGGGAATTCCTAGATGGAAAAAAAGAAGACAGTGGTGCGAA
TGCTTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail