Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g10330.t1
Gene name
Locationscaffold_113:24707..33248
Strand-
Gene length (bp)8541
Transcript length (bp)8382
Coding sequence length (bp)8382
Protein length (aa) 2794

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.4E-78 241 636
PF00501 AMP-binding AMP-binding enzyme 1.3E-77 1749 2143
PF00668 Condensation Condensation domain 9.2E-11 857 1166
PF00668 Condensation Condensation domain 6.7E-44 1298 1721
PF00668 Condensation Condensation domain 1.3E-30 2369 2786
PF00550 PP-binding Phosphopantetheine attachment site 7.5E-07 780 833
PF00550 PP-binding Phosphopantetheine attachment site 7.1E-13 2285 2346

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g10330.t1
MAPIALSTPQPSHLSIPSKSFKSIKDDTTIVTREPASIDGFLPVEVKTGDTAEVSGVLCTAFGLALRCYNTEGVH
FEYHHETATGSSSTNLLFELDEFRKVEDLLQAVKATLHSARSALETPDEKQQTQSYQSFRSAVIFREESLNSKHI
SPSPNFDLELHATNSRNGIEIHMLYTPSTVSEDLAVHLADTLHRTFELVNNHSETELSSASYLGPLSHKRIFNWN
SNAPNAVIECAHELVRKTASLQPQAPAIDSWDAQMTYAELDSLSNHLATVLVELGIKAEVIVPLCFEKSAWYVVA
LLAVLKAGGAFVPLDPTHPSSRLREIVSQVDAPIILTTAKHHDLFDDFSVKTMIVNEDTVGTITSGDGCLTPVTV
TPENLAYVIFTSGSTGKPKGTMIQHQSFCSGSLRQGEAANMGPHSRIFQFASYSFDVSILEILTGLIFGACICIP
NEQLGRADFVQSMNDFRVNWAFLTPSVLKVLTPDQLPLLKTLVLGGEAMSESDMMTWAGRLQLMNGYGPSECSVA
ATANTQLNPQSSPRNIGRAIGGVCWIVDPQNHNVLLPVGATGELIIQGPIVSRGYIKDPVKTSSAFFRNPAWMVP
GTSSIWNRFYKTGDLVRYDADGMIHFIGRKDHQVKLNGQRMELGEVEHHLWTDPVIRNGMALIPYTGHCKSRLVG
IVSLHKHFTTASIQTHTSIRLVNHAEAAADTQAIAERLSHLLPTYMVPTIWIVLESLPLMSSGKMDRKKVGDFVA
DMSTEAFQHIIGNSTKPGDKASWTKTEILVQKVWAKALNVPEEQIGKHSSFLSVGGDSIKAMAVMSEFRKLGVTV
LVADLLRYNVTEIASKLEESGSADVLRRSETDHLPISHLQRTFLEASRSGNSAIHHAMLLELNHKISIQQLNDAL
DSIVSSYPALTLGFNEQNGTWLQTFRDHDELENPVYHLNLNHVSSLEEAQEIMQHRQASVGVSGNPNLMIDLFSL
RGTQHISLVVHAAILNSQSLSTVIGHLDYLLQSNDEKEENVWESKLLSRDEFSHAWLDHLRSDTGMEPMNGPLQS
VALESLSGYRDYVTETLELGSEITGLLTGPCNLKFGTNAGDIFLATLILSYHQILEENDHSTLAIVETTATESTL
SKHLRGHVGQFSSLQPVHVPVEHSDQVTLQLIRDTKDKVRQRGIGSKLGSSNVIFNYGLSSRLTEGIVLKQATLT
RRHGLGAIVPTTFEVSCLLEDGQFRITVGSDQVSAQKLLLFTDQYRQNITQAVEILASNTAKEFTLADFPLLKLD
HPSLERVNRQHLPRVGLRPNQIEDMYPCSPLQQGLLMSQARKQGSYNVFIGWEVVSCGANDTVDIGRLLSSWQKV
VDHHPALRTIFTDEFGGKEPYAQIVLRRPRAEVSVKPCSDVDVASVLEETIELGTNPVVPPHRFSINVTADDRVF
CRVDASHTIVDGVSKSLILRDLKRAYAGTLLSPTGGAKYRDFVQYVAANDMSASISFWQNHLAEVEPCYFPKLAE
AEGTPELKYVQVELGIPTSVLRDFCVSQSITISNLLQTVWALVCRVYVGRDDICFGYLASGRDAPVEDLVNMVGP
TISVLICKALLEDSTIIKDALKACQEEFLDSLAHQQCSLAEIQHSLGLAGMPLFNTGISFQTMTDVDSDDVITNI
DFEGLIVREPTEYNITVHVVDSPNNVDIKLGYWTDCISESRAGSVSGTFSAILKSVVEHPEARVDQLNVIGRYDL
SQIVSWNQDVPEISSYTVPDLVLQQITRTPHAIAIDTMAEKITYQDFGRMWLSLSRYLTRLGIGAGDYVPLTFEK
SAWAIVAMFAVLGTGAAFVPLDPKTPVERLREASIQTAANVVLASPKYASNWNDLIPTIVSVDQDLLDKLNEEQD
DLDQGVVRARPHHDAYVIFTSGSTGKPKGCVVQHSAFCSGALAQGKLACLGPSSRVLQFASYSFDVSLLEIMTSL
MFGACICVPDEDLSKDIKHCINVLNINWTFLTPSVLKLLQPSDVPSLKTLVLGGEALSKGDILNWADRVQLYNGY
GPSECSVAAAANPGLQPTTDPANIGHAVGGVLWIVDAKQPSKLLPIGAVGELLISGPILARGYLGDPEKTAAAFV
KQKSFVPGSHKRERYYRTGDLVRYNADGTIHFIGRADGQVKIRGQRVELGEIEYNIERDENIHQALTLLPSQGPF
KKQLLAVVSFKGFDLPVEEGRLTLVPEDRRPKIMAVVTRIANTISAALPIYMVPALWVPVNAIPLLPSGKLDRKK
VRRWVETLDDATYEQIANVGSKASGRGPSTPAEFELRRIWASVLNRPEEQISMERSFQSLGGDSISAMQVIAQCR
DAKLSLAVKDLIQCPTIAELAPRVRPLDEDAEPMEDDIDVPFNLSPQQTWEFDLKQHCDLNRYNTTFLLSVHSDS
DLKPVVDATVERHPMLRARFQRDESGRWMQYIPLDRSNSHLYQELEVPDLEAIEPYTAPNQSGFDLQRGPLMRAI
IFKLPNGDRYVGLTVHHMVIDTVSWRILLQDMQQGLSTGTITSHRSDSFALWCRKLKEHADEKWTPEYVLPFSIP
APLYDYWQMEESMNLFVTETIQEFSLDTKTTARLMGNCNHQYQTKPLDIFLSAIFHAFSATFTDRPVPAVFIYSH
GRDEFGGDLDVSNTIGWFTSSTPVVINPSGDIVDDLQAVRDARASVPGNGVPYWATRWLTDDGHAAFEHHSPFEL
SMNYLGQYQQLERDDSVLRYVDVKKPKATGSGSGLLRTALVETQAIVIGDSLQIKFVYNTRMARQKQLLDWQAKV
KDSLLEIANRLGDGVETE*
Coding >Ani_SJS100_1|g10330.t1
ATGGCTCCGATCGCTTTATCCACTCCTCAACCATCTCATCTTAGCATCCCTTCCAAGTCTTTCAAGAGCATCAAA
GATGACACCACCATAGTCACAAGAGAACCTGCTTCGATAGACGGCTTTTTGCCTGTTGAAGTGAAGACAGGAGAC
ACAGCAGAGGTATCTGGAGTACTCTGCACAGCCTTTGGCCTTGCCCTTCGTTGCTATAATACCGAAGGCGTGCAT
TTTGAATACCATCACGAGACAGCAACTGGTTCCAGCTCCACGAATCTATTGTTCGAGTTGGACGAGTTCCGCAAA
GTTGAGGACCTTCTCCAAGCAGTGAAGGCAACATTGCATAGTGCTCGATCAGCCTTGGAGACACCAGACGAGAAA
CAGCAAACTCAATCCTACCAGTCCTTCCGCAGCGCCGTAATCTTTCGTGAAGAGAGTTTAAATAGTAAACACATC
TCGCCATCACCAAATTTTGACCTCGAACTTCATGCCACAAATAGTAGAAATGGCATTGAGATCCACATGCTCTAT
ACTCCGTCTACAGTATCTGAGGACCTTGCAGTCCATTTGGCCGATACTCTCCATCGGACATTCGAATTGGTCAAC
AACCACTCAGAGACTGAGCTTTCGAGTGCAAGCTACTTGGGCCCACTCAGCCATAAGAGGATTTTCAACTGGAAT
TCCAACGCGCCTAATGCGGTGATTGAGTGCGCTCATGAGCTAGTTAGAAAGACAGCGTCCTTGCAACCACAGGCT
CCTGCTATTGATTCATGGGATGCACAGATGACGTATGCAGAGCTGGATTCTCTGTCAAACCATCTGGCTACGGTG
TTGGTGGAACTGGGAATCAAGGCCGAGGTGATTGTGCCTCTGTGTTTTGAAAAGTCTGCATGGTATGTCGTGGCG
TTGCTTGCAGTACTCAAAGCCGGTGGTGCCTTTGTTCCCCTCGACCCGACGCATCCCTCATCACGTCTACGAGAG
ATCGTCAGCCAAGTTGATGCACCGATTATTTTGACGACAGCCAAACATCACGATCTCTTCGATGACTTTTCTGTC
AAGACAATGATAGTCAATGAAGACACAGTCGGGACAATAACTAGTGGTGACGGGTGTCTTACTCCAGTCACCGTC
ACGCCTGAGAATCTCGCATATGTGATCTTTACCTCTGGGAGCACTGGAAAGCCCAAAGGTACGATGATCCAGCAC
CAGTCCTTCTGCAGTGGGTCTCTGCGACAGGGTGAAGCGGCCAACATGGGACCTCATTCCCGGATATTCCAGTTC
GCTTCATACAGCTTTGACGTGAGTATTTTGGAAATCCTCACGGGCCTTATATTCGGCGCCTGCATCTGTATCCCG
AACGAGCAGCTTGGTCGTGCAGACTTTGTCCAGTCCATGAATGACTTTCGTGTCAACTGGGCCTTCTTGACACCG
TCGGTGTTGAAGGTGCTGACTCCTGATCAACTGCCGCTTTTGAAGACTCTGGTACTGGGAGGCGAAGCTATGTCA
GAGTCGGATATGATGACATGGGCGGGAAGGCTCCAGTTGATGAATGGCTATGGGCCAAGTGAATGCTCCGTCGCA
GCCACTGCCAATACTCAGCTCAACCCCCAGTCCAGCCCACGGAATATTGGTAGAGCAATTGGTGGCGTATGCTGG
ATTGTTGATCCGCAAAACCACAACGTGCTTCTCCCTGTTGGCGCCACAGGTGAGCTGATCATCCAAGGTCCTATT
GTCTCGCGTGGATATATCAAGGATCCTGTGAAGACTTCATCAGCCTTCTTTAGAAACCCGGCTTGGATGGTGCCG
GGTACATCCTCAATCTGGAATCGCTTTTACAAGACTGGTGATCTGGTACGATATGATGCGGACGGCATGATTCAC
TTCATTGGGCGTAAGGACCACCAAGTCAAGCTCAATGGACAGCGTATGGAATTAGGGGAGGTAGAGCACCACCTC
TGGACAGATCCAGTCATCCGTAACGGAATGGCTCTCATTCCCTACACTGGTCACTGCAAATCCCGCTTGGTTGGT
ATCGTGTCTCTCCACAAGCATTTTACAACCGCTTCAATACAGACACACACGAGTATTCGCCTGGTAAATCATGCC
GAGGCCGCAGCAGACACCCAAGCGATTGCAGAAAGGCTGTCACACCTGCTCCCCACGTATATGGTCCCAACCATC
TGGATTGTCCTGGAGAGTCTTCCACTCATGTCGTCGGGCAAGATGGACCGGAAGAAGGTTGGGGATTTTGTTGCT
GATATGAGCACCGAGGCCTTCCAACACATCATAGGTAACTCAACAAAACCTGGCGACAAGGCGTCTTGGACCAAG
ACAGAGATTCTCGTGCAGAAGGTTTGGGCGAAAGCTCTGAACGTACCAGAGGAGCAAATTGGCAAACACAGCAGC
TTCCTGTCTGTGGGCGGTGACTCTATCAAAGCGATGGCCGTCATGTCAGAGTTCCGCAAACTCGGAGTCACCGTC
CTAGTAGCTGATCTGTTGCGGTACAATGTTACTGAGATCGCCTCTAAGCTGGAGGAGTCTGGCTCTGCGGATGTG
CTCCGGAGAAGCGAGACAGATCACCTTCCCATATCACACCTACAGCGCACCTTCCTCGAGGCGTCCCGTTCGGGC
AACAGCGCCATACACCACGCCATGTTACTGGAACTCAATCACAAGATTAGTATCCAGCAGCTGAATGATGCCTTG
GATAGTATCGTTTCTTCCTACCCAGCACTCACCCTCGGCTTCAATGAGCAGAACGGGACATGGTTGCAAACATTC
AGAGACCACGACGAGCTTGAAAACCCCGTTTACCACTTGAATCTGAACCATGTCTCTAGCTTGGAAGAAGCACAA
GAAATTATGCAGCATCGTCAGGCGTCAGTTGGTGTGAGTGGTAACCCAAATCTCATGATCGATCTGTTCTCTCTT
CGCGGCACACAGCACATTTCTCTCGTCGTGCATGCAGCTATCCTTAATTCACAGTCTCTAAGTACTGTCATCGGC
CATCTCGATTACTTGCTTCAGTCAAATGATGAAAAAGAGGAAAACGTCTGGGAAAGTAAGCTTTTGTCCCGAGAT
GAGTTCTCTCATGCCTGGCTTGATCACCTCAGGAGCGATACTGGCATGGAGCCTATGAATGGTCCATTGCAATCT
GTCGCCCTTGAATCTCTTAGTGGGTATCGAGACTATGTCACAGAGACGCTAGAACTCGGCTCCGAGATTACTGGG
CTTCTCACTGGACCGTGCAACCTAAAATTTGGCACCAACGCGGGGGATATATTTCTGGCGACCTTGATCCTGTCA
TACCACCAAATTCTAGAAGAAAATGACCACTCTACCTTAGCTATTGTCGAAACAACCGCTACTGAGTCGACTCTT
AGCAAACACTTGAGAGGTCATGTCGGTCAATTCTCTTCGCTGCAACCCGTGCATGTGCCTGTGGAACACTCGGAC
CAAGTCACTCTTCAGCTAATCCGGGATACTAAGGACAAAGTTCGCCAGAGGGGGATAGGTAGCAAGCTTGGCTCT
TCCAATGTCATCTTCAACTACGGCTTGTCTAGCCGACTTACAGAAGGTATCGTGTTGAAGCAAGCCACCCTCACT
CGGCGACACGGCTTGGGCGCCATCGTTCCCACAACTTTCGAGGTTTCATGTCTGCTCGAAGATGGACAGTTCAGA
ATCACAGTCGGATCCGATCAGGTCAGCGCTCAGAAGCTATTACTATTTACCGACCAGTACAGACAGAACATCACG
CAAGCAGTCGAGATCCTCGCGTCCAATACAGCTAAGGAATTCACTTTGGCGGACTTTCCATTGCTCAAACTCGAT
CATCCATCCCTTGAGAGAGTCAACCGTCAGCACCTTCCACGAGTTGGCCTTAGACCAAATCAGATAGAAGATATG
TATCCCTGCTCTCCGTTGCAGCAAGGTCTCCTTATGAGCCAGGCTAGGAAGCAAGGCAGTTACAATGTATTCATT
GGATGGGAGGTAGTCTCTTGCGGCGCAAACGACACAGTTGATATTGGCAGATTGCTCTCCTCATGGCAAAAGGTA
GTCGACCATCACCCTGCCCTGAGGACTATATTCACCGACGAATTTGGCGGCAAGGAGCCATACGCTCAAATTGTT
CTGAGACGTCCCAGGGCGGAGGTTTCGGTGAAACCTTGCTCAGATGTCGATGTTGCATCTGTGCTGGAGGAGACG
ATTGAACTAGGCACTAACCCTGTTGTCCCTCCACATCGGTTCTCAATCAATGTCACAGCGGATGATAGAGTGTTC
TGCCGAGTCGATGCTAGTCATACCATTGTCGATGGTGTATCCAAGTCATTGATTCTAAGGGACCTGAAGCGAGCT
TATGCGGGGACTCTTCTTTCTCCCACTGGAGGCGCTAAGTACAGGGACTTCGTCCAATATGTTGCTGCAAACGAC
ATGTCCGCTAGCATTTCTTTCTGGCAGAACCATCTTGCCGAAGTCGAGCCCTGCTACTTTCCCAAATTAGCTGAG
GCTGAAGGTACACCTGAGCTGAAGTACGTCCAGGTAGAGCTAGGAATACCTACCAGTGTTCTGCGTGACTTCTGT
GTCTCCCAGAGTATCACAATCTCGAACCTTCTACAGACAGTCTGGGCACTCGTCTGTCGGGTGTATGTCGGCCGA
GATGATATTTGTTTCGGTTACTTGGCATCCGGAAGAGATGCACCTGTCGAAGACCTAGTCAACATGGTCGGGCCA
ACTATCAGTGTCCTCATTTGCAAGGCATTGCTGGAGGACTCCACTATTATCAAGGACGCCTTGAAGGCTTGCCAG
GAAGAGTTCCTTGATTCTCTCGCACACCAGCAATGCTCGCTCGCCGAGATTCAACATTCACTTGGACTCGCAGGA
ATGCCTCTGTTTAACACAGGCATTTCCTTCCAGACAATGACAGACGTTGATAGTGACGACGTTATCACCAATATT
GACTTCGAGGGTCTCATTGTACGGGAGCCGACAGAGTACAATATCACGGTTCACGTTGTCGATTCGCCAAACAAC
GTGGACATCAAACTCGGATATTGGACTGATTGTATCTCAGAATCCCGAGCTGGATCCGTATCGGGAACATTCTCT
GCCATCCTCAAATCCGTGGTCGAACATCCAGAGGCCCGAGTTGATCAGCTCAATGTTATCGGCCGGTATGATTTG
TCGCAGATTGTATCTTGGAATCAGGATGTGCCGGAGATTTCATCGTACACAGTACCGGACCTCGTGCTCCAACAG
ATTACGCGTACCCCTCATGCTATTGCGATTGACACCATGGCCGAAAAGATAACCTATCAGGATTTTGGACGGATG
TGGCTGTCGTTGTCTCGATACTTGACCAGGCTTGGTATTGGCGCCGGGGATTACGTGCCTTTGACGTTCGAAAAG
TCAGCATGGGCTATCGTTGCCATGTTTGCTGTTCTGGGTACTGGAGCTGCGTTCGTCCCTCTGGATCCTAAAACC
CCGGTGGAGCGCCTACGCGAGGCCTCTATTCAAACTGCTGCTAACGTTGTTCTTGCATCTCCGAAATATGCTTCA
AACTGGAACGACCTTATTCCAACCATTGTCAGTGTTGACCAGGATCTCCTCGACAAGCTGAACGAAGAACAAGAC
GATCTCGACCAAGGTGTCGTGAGAGCCCGCCCCCATCATGATGCCTACGTTATCTTCACTTCGGGCAGCACAGGC
AAGCCAAAAGGATGTGTTGTGCAGCATTCTGCATTCTGCTCTGGAGCCCTGGCTCAAGGAAAGCTTGCCTGTCTG
GGTCCCTCATCACGAGTACTGCAGTTTGCTTCCTACAGCTTCGACGTTAGTCTGCTGGAAATCATGACATCACTC
ATGTTTGGTGCATGCATTTGCGTGCCGGACGAAGACTTGAGCAAGGACATCAAGCACTGCATCAACGTGCTCAAT
ATCAACTGGACATTCCTTACGCCATCTGTCCTTAAGCTTTTACAACCGTCCGATGTGCCCTCATTGAAGACTTTG
GTTCTTGGCGGCGAAGCTCTCTCAAAGGGTGACATTCTCAACTGGGCTGACAGGGTACAGCTGTACAACGGATAC
GGACCTAGTGAGTGCTCTGTGGCAGCAGCAGCTAACCCAGGATTGCAACCTACTACCGATCCAGCCAACATTGGA
CATGCTGTTGGTGGTGTGCTCTGGATTGTTGATGCCAAGCAACCTTCGAAGCTACTTCCCATTGGTGCTGTTGGT
GAGCTCTTGATTTCAGGTCCAATTCTGGCGAGAGGCTACCTGGGTGATCCTGAGAAAACAGCAGCCGCCTTTGTC
AAACAGAAGAGCTTTGTTCCAGGATCTCACAAGCGTGAGCGGTATTACCGCACTGGTGATCTTGTGCGATACAAT
GCAGATGGCACGATTCATTTCATCGGCAGAGCTGATGGGCAGGTGAAGATTCGCGGCCAGCGGGTTGAATTGGGC
GAGATCGAGTACAATATCGAGCGTGATGAGAATATCCACCAGGCACTCACTTTGCTCCCATCTCAGGGCCCATTC
AAGAAGCAGCTATTGGCCGTTGTTTCTTTCAAAGGCTTCGATCTCCCTGTTGAGGAGGGACGATTAACTCTCGTG
CCGGAGGACAGGAGACCCAAGATTATGGCGGTCGTGACCAGAATCGCTAACACCATATCTGCAGCCCTTCCGATT
TACATGGTGCCGGCCCTGTGGGTACCAGTGAACGCGATCCCCTTGTTGCCTTCCGGAAAGCTGGACCGGAAGAAG
GTCCGGCGATGGGTCGAGACCCTGGACGATGCCACATATGAGCAGATTGCCAACGTAGGATCCAAAGCTAGCGGC
CGCGGCCCGAGTACACCTGCCGAATTTGAGCTGAGACGCATTTGGGCCTCCGTGCTAAATCGACCCGAAGAGCAA
ATCAGTATGGAGCGGTCCTTCCAAAGCCTTGGTGGCGATTCCATCTCCGCTATGCAGGTTATCGCCCAGTGCCGT
GATGCCAAGCTCTCGCTCGCAGTTAAGGATCTCATTCAGTGTCCCACTATCGCCGAACTGGCACCGAGAGTGCGA
CCTTTGGACGAAGATGCTGAGCCAATGGAAGACGATATTGATGTTCCGTTTAATCTTTCTCCTCAGCAGACCTGG
GAGTTCGACCTGAAACAGCACTGCGATCTCAATCGTTACAACACTACGTTCCTGCTATCGGTTCATTCTGATTCC
GACCTAAAACCGGTCGTGGATGCAACAGTAGAGCGTCATCCCATGCTCCGTGCTCGGTTCCAGCGCGATGAATCG
GGCCGCTGGATGCAGTATATTCCTCTTGACCGGTCCAATAGTCATCTGTACCAGGAGTTGGAAGTGCCTGACTTG
GAAGCTATTGAACCATACACTGCGCCCAACCAGTCTGGCTTCGATTTGCAGCGTGGTCCATTGATGCGTGCGATT
ATTTTCAAGCTTCCGAACGGAGACCGGTACGTTGGACTTACTGTACACCACATGGTTATCGACACCGTTTCATGG
CGCATTCTTCTCCAAGATATGCAACAAGGCTTATCCACCGGGACAATCACCTCCCACCGTTCCGACTCATTTGCC
TTGTGGTGCCGTAAACTCAAGGAGCACGCTGATGAGAAATGGACTCCCGAATATGTACTACCTTTCTCGATTCCT
GCTCCACTGTACGATTACTGGCAGATGGAGGAATCCATGAACCTTTTCGTGACCGAAACTATCCAGGAGTTCTCT
CTGGACACCAAGACAACCGCCCGCTTGATGGGAAATTGCAACCATCAGTACCAGACTAAGCCACTTGACATCTTC
TTGTCGGCGATCTTCCATGCCTTCAGCGCGACGTTCACTGACCGTCCCGTACCTGCGGTCTTTATCTACAGTCAT
GGTCGGGATGAGTTTGGTGGAGATCTTGATGTATCTAACACTATCGGATGGTTTACCTCCTCCACTCCGGTAGTG
ATAAACCCATCTGGAGATATTGTCGACGACCTGCAGGCTGTGCGAGATGCGCGCGCCAGTGTGCCAGGCAATGGA
GTTCCCTACTGGGCAACCCGCTGGCTGACCGACGATGGCCATGCCGCCTTTGAACATCACAGCCCCTTCGAGTTG
TCTATGAACTACCTTGGCCAGTATCAGCAGCTGGAGCGCGACGATTCGGTACTTCGTTATGTGGATGTGAAGAAG
CCCAAGGCAACTGGATCTGGGTCCGGTCTCCTCCGCACCGCGCTGGTTGAGACGCAAGCCATTGTTATCGGTGAC
TCGCTGCAGATCAAGTTCGTTTATAACACGCGCATGGCCCGGCAGAAGCAGCTCCTCGACTGGCAGGCCAAGGTG
AAGGATTCGCTACTGGAGATTGCCAATCGCCTCGGAGATGGTGTTGAGACTGAGTGA
Transcript >Ani_SJS100_1|g10330.t1
ATGGCTCCGATCGCTTTATCCACTCCTCAACCATCTCATCTTAGCATCCCTTCCAAGTCTTTCAAGAGCATCAAA
GATGACACCACCATAGTCACAAGAGAACCTGCTTCGATAGACGGCTTTTTGCCTGTTGAAGTGAAGACAGGAGAC
ACAGCAGAGGTATCTGGAGTACTCTGCACAGCCTTTGGCCTTGCCCTTCGTTGCTATAATACCGAAGGCGTGCAT
TTTGAATACCATCACGAGACAGCAACTGGTTCCAGCTCCACGAATCTATTGTTCGAGTTGGACGAGTTCCGCAAA
GTTGAGGACCTTCTCCAAGCAGTGAAGGCAACATTGCATAGTGCTCGATCAGCCTTGGAGACACCAGACGAGAAA
CAGCAAACTCAATCCTACCAGTCCTTCCGCAGCGCCGTAATCTTTCGTGAAGAGAGTTTAAATAGTAAACACATC
TCGCCATCACCAAATTTTGACCTCGAACTTCATGCCACAAATAGTAGAAATGGCATTGAGATCCACATGCTCTAT
ACTCCGTCTACAGTATCTGAGGACCTTGCAGTCCATTTGGCCGATACTCTCCATCGGACATTCGAATTGGTCAAC
AACCACTCAGAGACTGAGCTTTCGAGTGCAAGCTACTTGGGCCCACTCAGCCATAAGAGGATTTTCAACTGGAAT
TCCAACGCGCCTAATGCGGTGATTGAGTGCGCTCATGAGCTAGTTAGAAAGACAGCGTCCTTGCAACCACAGGCT
CCTGCTATTGATTCATGGGATGCACAGATGACGTATGCAGAGCTGGATTCTCTGTCAAACCATCTGGCTACGGTG
TTGGTGGAACTGGGAATCAAGGCCGAGGTGATTGTGCCTCTGTGTTTTGAAAAGTCTGCATGGTATGTCGTGGCG
TTGCTTGCAGTACTCAAAGCCGGTGGTGCCTTTGTTCCCCTCGACCCGACGCATCCCTCATCACGTCTACGAGAG
ATCGTCAGCCAAGTTGATGCACCGATTATTTTGACGACAGCCAAACATCACGATCTCTTCGATGACTTTTCTGTC
AAGACAATGATAGTCAATGAAGACACAGTCGGGACAATAACTAGTGGTGACGGGTGTCTTACTCCAGTCACCGTC
ACGCCTGAGAATCTCGCATATGTGATCTTTACCTCTGGGAGCACTGGAAAGCCCAAAGGTACGATGATCCAGCAC
CAGTCCTTCTGCAGTGGGTCTCTGCGACAGGGTGAAGCGGCCAACATGGGACCTCATTCCCGGATATTCCAGTTC
GCTTCATACAGCTTTGACGTGAGTATTTTGGAAATCCTCACGGGCCTTATATTCGGCGCCTGCATCTGTATCCCG
AACGAGCAGCTTGGTCGTGCAGACTTTGTCCAGTCCATGAATGACTTTCGTGTCAACTGGGCCTTCTTGACACCG
TCGGTGTTGAAGGTGCTGACTCCTGATCAACTGCCGCTTTTGAAGACTCTGGTACTGGGAGGCGAAGCTATGTCA
GAGTCGGATATGATGACATGGGCGGGAAGGCTCCAGTTGATGAATGGCTATGGGCCAAGTGAATGCTCCGTCGCA
GCCACTGCCAATACTCAGCTCAACCCCCAGTCCAGCCCACGGAATATTGGTAGAGCAATTGGTGGCGTATGCTGG
ATTGTTGATCCGCAAAACCACAACGTGCTTCTCCCTGTTGGCGCCACAGGTGAGCTGATCATCCAAGGTCCTATT
GTCTCGCGTGGATATATCAAGGATCCTGTGAAGACTTCATCAGCCTTCTTTAGAAACCCGGCTTGGATGGTGCCG
GGTACATCCTCAATCTGGAATCGCTTTTACAAGACTGGTGATCTGGTACGATATGATGCGGACGGCATGATTCAC
TTCATTGGGCGTAAGGACCACCAAGTCAAGCTCAATGGACAGCGTATGGAATTAGGGGAGGTAGAGCACCACCTC
TGGACAGATCCAGTCATCCGTAACGGAATGGCTCTCATTCCCTACACTGGTCACTGCAAATCCCGCTTGGTTGGT
ATCGTGTCTCTCCACAAGCATTTTACAACCGCTTCAATACAGACACACACGAGTATTCGCCTGGTAAATCATGCC
GAGGCCGCAGCAGACACCCAAGCGATTGCAGAAAGGCTGTCACACCTGCTCCCCACGTATATGGTCCCAACCATC
TGGATTGTCCTGGAGAGTCTTCCACTCATGTCGTCGGGCAAGATGGACCGGAAGAAGGTTGGGGATTTTGTTGCT
GATATGAGCACCGAGGCCTTCCAACACATCATAGGTAACTCAACAAAACCTGGCGACAAGGCGTCTTGGACCAAG
ACAGAGATTCTCGTGCAGAAGGTTTGGGCGAAAGCTCTGAACGTACCAGAGGAGCAAATTGGCAAACACAGCAGC
TTCCTGTCTGTGGGCGGTGACTCTATCAAAGCGATGGCCGTCATGTCAGAGTTCCGCAAACTCGGAGTCACCGTC
CTAGTAGCTGATCTGTTGCGGTACAATGTTACTGAGATCGCCTCTAAGCTGGAGGAGTCTGGCTCTGCGGATGTG
CTCCGGAGAAGCGAGACAGATCACCTTCCCATATCACACCTACAGCGCACCTTCCTCGAGGCGTCCCGTTCGGGC
AACAGCGCCATACACCACGCCATGTTACTGGAACTCAATCACAAGATTAGTATCCAGCAGCTGAATGATGCCTTG
GATAGTATCGTTTCTTCCTACCCAGCACTCACCCTCGGCTTCAATGAGCAGAACGGGACATGGTTGCAAACATTC
AGAGACCACGACGAGCTTGAAAACCCCGTTTACCACTTGAATCTGAACCATGTCTCTAGCTTGGAAGAAGCACAA
GAAATTATGCAGCATCGTCAGGCGTCAGTTGGTGTGAGTGGTAACCCAAATCTCATGATCGATCTGTTCTCTCTT
CGCGGCACACAGCACATTTCTCTCGTCGTGCATGCAGCTATCCTTAATTCACAGTCTCTAAGTACTGTCATCGGC
CATCTCGATTACTTGCTTCAGTCAAATGATGAAAAAGAGGAAAACGTCTGGGAAAGTAAGCTTTTGTCCCGAGAT
GAGTTCTCTCATGCCTGGCTTGATCACCTCAGGAGCGATACTGGCATGGAGCCTATGAATGGTCCATTGCAATCT
GTCGCCCTTGAATCTCTTAGTGGGTATCGAGACTATGTCACAGAGACGCTAGAACTCGGCTCCGAGATTACTGGG
CTTCTCACTGGACCGTGCAACCTAAAATTTGGCACCAACGCGGGGGATATATTTCTGGCGACCTTGATCCTGTCA
TACCACCAAATTCTAGAAGAAAATGACCACTCTACCTTAGCTATTGTCGAAACAACCGCTACTGAGTCGACTCTT
AGCAAACACTTGAGAGGTCATGTCGGTCAATTCTCTTCGCTGCAACCCGTGCATGTGCCTGTGGAACACTCGGAC
CAAGTCACTCTTCAGCTAATCCGGGATACTAAGGACAAAGTTCGCCAGAGGGGGATAGGTAGCAAGCTTGGCTCT
TCCAATGTCATCTTCAACTACGGCTTGTCTAGCCGACTTACAGAAGGTATCGTGTTGAAGCAAGCCACCCTCACT
CGGCGACACGGCTTGGGCGCCATCGTTCCCACAACTTTCGAGGTTTCATGTCTGCTCGAAGATGGACAGTTCAGA
ATCACAGTCGGATCCGATCAGGTCAGCGCTCAGAAGCTATTACTATTTACCGACCAGTACAGACAGAACATCACG
CAAGCAGTCGAGATCCTCGCGTCCAATACAGCTAAGGAATTCACTTTGGCGGACTTTCCATTGCTCAAACTCGAT
CATCCATCCCTTGAGAGAGTCAACCGTCAGCACCTTCCACGAGTTGGCCTTAGACCAAATCAGATAGAAGATATG
TATCCCTGCTCTCCGTTGCAGCAAGGTCTCCTTATGAGCCAGGCTAGGAAGCAAGGCAGTTACAATGTATTCATT
GGATGGGAGGTAGTCTCTTGCGGCGCAAACGACACAGTTGATATTGGCAGATTGCTCTCCTCATGGCAAAAGGTA
GTCGACCATCACCCTGCCCTGAGGACTATATTCACCGACGAATTTGGCGGCAAGGAGCCATACGCTCAAATTGTT
CTGAGACGTCCCAGGGCGGAGGTTTCGGTGAAACCTTGCTCAGATGTCGATGTTGCATCTGTGCTGGAGGAGACG
ATTGAACTAGGCACTAACCCTGTTGTCCCTCCACATCGGTTCTCAATCAATGTCACAGCGGATGATAGAGTGTTC
TGCCGAGTCGATGCTAGTCATACCATTGTCGATGGTGTATCCAAGTCATTGATTCTAAGGGACCTGAAGCGAGCT
TATGCGGGGACTCTTCTTTCTCCCACTGGAGGCGCTAAGTACAGGGACTTCGTCCAATATGTTGCTGCAAACGAC
ATGTCCGCTAGCATTTCTTTCTGGCAGAACCATCTTGCCGAAGTCGAGCCCTGCTACTTTCCCAAATTAGCTGAG
GCTGAAGGTACACCTGAGCTGAAGTACGTCCAGGTAGAGCTAGGAATACCTACCAGTGTTCTGCGTGACTTCTGT
GTCTCCCAGAGTATCACAATCTCGAACCTTCTACAGACAGTCTGGGCACTCGTCTGTCGGGTGTATGTCGGCCGA
GATGATATTTGTTTCGGTTACTTGGCATCCGGAAGAGATGCACCTGTCGAAGACCTAGTCAACATGGTCGGGCCA
ACTATCAGTGTCCTCATTTGCAAGGCATTGCTGGAGGACTCCACTATTATCAAGGACGCCTTGAAGGCTTGCCAG
GAAGAGTTCCTTGATTCTCTCGCACACCAGCAATGCTCGCTCGCCGAGATTCAACATTCACTTGGACTCGCAGGA
ATGCCTCTGTTTAACACAGGCATTTCCTTCCAGACAATGACAGACGTTGATAGTGACGACGTTATCACCAATATT
GACTTCGAGGGTCTCATTGTACGGGAGCCGACAGAGTACAATATCACGGTTCACGTTGTCGATTCGCCAAACAAC
GTGGACATCAAACTCGGATATTGGACTGATTGTATCTCAGAATCCCGAGCTGGATCCGTATCGGGAACATTCTCT
GCCATCCTCAAATCCGTGGTCGAACATCCAGAGGCCCGAGTTGATCAGCTCAATGTTATCGGCCGGTATGATTTG
TCGCAGATTGTATCTTGGAATCAGGATGTGCCGGAGATTTCATCGTACACAGTACCGGACCTCGTGCTCCAACAG
ATTACGCGTACCCCTCATGCTATTGCGATTGACACCATGGCCGAAAAGATAACCTATCAGGATTTTGGACGGATG
TGGCTGTCGTTGTCTCGATACTTGACCAGGCTTGGTATTGGCGCCGGGGATTACGTGCCTTTGACGTTCGAAAAG
TCAGCATGGGCTATCGTTGCCATGTTTGCTGTTCTGGGTACTGGAGCTGCGTTCGTCCCTCTGGATCCTAAAACC
CCGGTGGAGCGCCTACGCGAGGCCTCTATTCAAACTGCTGCTAACGTTGTTCTTGCATCTCCGAAATATGCTTCA
AACTGGAACGACCTTATTCCAACCATTGTCAGTGTTGACCAGGATCTCCTCGACAAGCTGAACGAAGAACAAGAC
GATCTCGACCAAGGTGTCGTGAGAGCCCGCCCCCATCATGATGCCTACGTTATCTTCACTTCGGGCAGCACAGGC
AAGCCAAAAGGATGTGTTGTGCAGCATTCTGCATTCTGCTCTGGAGCCCTGGCTCAAGGAAAGCTTGCCTGTCTG
GGTCCCTCATCACGAGTACTGCAGTTTGCTTCCTACAGCTTCGACGTTAGTCTGCTGGAAATCATGACATCACTC
ATGTTTGGTGCATGCATTTGCGTGCCGGACGAAGACTTGAGCAAGGACATCAAGCACTGCATCAACGTGCTCAAT
ATCAACTGGACATTCCTTACGCCATCTGTCCTTAAGCTTTTACAACCGTCCGATGTGCCCTCATTGAAGACTTTG
GTTCTTGGCGGCGAAGCTCTCTCAAAGGGTGACATTCTCAACTGGGCTGACAGGGTACAGCTGTACAACGGATAC
GGACCTAGTGAGTGCTCTGTGGCAGCAGCAGCTAACCCAGGATTGCAACCTACTACCGATCCAGCCAACATTGGA
CATGCTGTTGGTGGTGTGCTCTGGATTGTTGATGCCAAGCAACCTTCGAAGCTACTTCCCATTGGTGCTGTTGGT
GAGCTCTTGATTTCAGGTCCAATTCTGGCGAGAGGCTACCTGGGTGATCCTGAGAAAACAGCAGCCGCCTTTGTC
AAACAGAAGAGCTTTGTTCCAGGATCTCACAAGCGTGAGCGGTATTACCGCACTGGTGATCTTGTGCGATACAAT
GCAGATGGCACGATTCATTTCATCGGCAGAGCTGATGGGCAGGTGAAGATTCGCGGCCAGCGGGTTGAATTGGGC
GAGATCGAGTACAATATCGAGCGTGATGAGAATATCCACCAGGCACTCACTTTGCTCCCATCTCAGGGCCCATTC
AAGAAGCAGCTATTGGCCGTTGTTTCTTTCAAAGGCTTCGATCTCCCTGTTGAGGAGGGACGATTAACTCTCGTG
CCGGAGGACAGGAGACCCAAGATTATGGCGGTCGTGACCAGAATCGCTAACACCATATCTGCAGCCCTTCCGATT
TACATGGTGCCGGCCCTGTGGGTACCAGTGAACGCGATCCCCTTGTTGCCTTCCGGAAAGCTGGACCGGAAGAAG
GTCCGGCGATGGGTCGAGACCCTGGACGATGCCACATATGAGCAGATTGCCAACGTAGGATCCAAAGCTAGCGGC
CGCGGCCCGAGTACACCTGCCGAATTTGAGCTGAGACGCATTTGGGCCTCCGTGCTAAATCGACCCGAAGAGCAA
ATCAGTATGGAGCGGTCCTTCCAAAGCCTTGGTGGCGATTCCATCTCCGCTATGCAGGTTATCGCCCAGTGCCGT
GATGCCAAGCTCTCGCTCGCAGTTAAGGATCTCATTCAGTGTCCCACTATCGCCGAACTGGCACCGAGAGTGCGA
CCTTTGGACGAAGATGCTGAGCCAATGGAAGACGATATTGATGTTCCGTTTAATCTTTCTCCTCAGCAGACCTGG
GAGTTCGACCTGAAACAGCACTGCGATCTCAATCGTTACAACACTACGTTCCTGCTATCGGTTCATTCTGATTCC
GACCTAAAACCGGTCGTGGATGCAACAGTAGAGCGTCATCCCATGCTCCGTGCTCGGTTCCAGCGCGATGAATCG
GGCCGCTGGATGCAGTATATTCCTCTTGACCGGTCCAATAGTCATCTGTACCAGGAGTTGGAAGTGCCTGACTTG
GAAGCTATTGAACCATACACTGCGCCCAACCAGTCTGGCTTCGATTTGCAGCGTGGTCCATTGATGCGTGCGATT
ATTTTCAAGCTTCCGAACGGAGACCGGTACGTTGGACTTACTGTACACCACATGGTTATCGACACCGTTTCATGG
CGCATTCTTCTCCAAGATATGCAACAAGGCTTATCCACCGGGACAATCACCTCCCACCGTTCCGACTCATTTGCC
TTGTGGTGCCGTAAACTCAAGGAGCACGCTGATGAGAAATGGACTCCCGAATATGTACTACCTTTCTCGATTCCT
GCTCCACTGTACGATTACTGGCAGATGGAGGAATCCATGAACCTTTTCGTGACCGAAACTATCCAGGAGTTCTCT
CTGGACACCAAGACAACCGCCCGCTTGATGGGAAATTGCAACCATCAGTACCAGACTAAGCCACTTGACATCTTC
TTGTCGGCGATCTTCCATGCCTTCAGCGCGACGTTCACTGACCGTCCCGTACCTGCGGTCTTTATCTACAGTCAT
GGTCGGGATGAGTTTGGTGGAGATCTTGATGTATCTAACACTATCGGATGGTTTACCTCCTCCACTCCGGTAGTG
ATAAACCCATCTGGAGATATTGTCGACGACCTGCAGGCTGTGCGAGATGCGCGCGCCAGTGTGCCAGGCAATGGA
GTTCCCTACTGGGCAACCCGCTGGCTGACCGACGATGGCCATGCCGCCTTTGAACATCACAGCCCCTTCGAGTTG
TCTATGAACTACCTTGGCCAGTATCAGCAGCTGGAGCGCGACGATTCGGTACTTCGTTATGTGGATGTGAAGAAG
CCCAAGGCAACTGGATCTGGGTCCGGTCTCCTCCGCACCGCGCTGGTTGAGACGCAAGCCATTGTTATCGGTGAC
TCGCTGCAGATCAAGTTCGTTTATAACACGCGCATGGCCCGGCAGAAGCAGCTCCTCGACTGGCAGGCCAAGGTG
AAGGATTCGCTACTGGAGATTGCCAATCGCCTCGGAGATGGTGTTGAGACTGAGTGA
Gene >Ani_SJS100_1|g10330.t1
ATGGCTCCGATCGCTTTATCCACTCCTCAACCATCTCATCTTAGCATCCCTTCCAAGTCTTTCAAGAGCATCAAA
GATGACACCACCATAGTCACAAGAGAACCTGCTTCGATAGACGGCTTTTTGCCTGTTGAAGTGAAGACAGGAGAC
ACAGCAGAGGTATCTGGAGTACTCTGCACAGCCTTTGGCCTTGCCCTTCGTTGCTATAATACCGAAGGCGTGCAT
TTTGAATACCATCACGAGACAGCAACTGGTTCCAGCTCCACGAGTGAGTATTGTATGCAGAGCCCCAAAATCAGC
ACAAGCTAACGATAACCACAGATCTATTGTTCGAGTTGGACGAGTTCCGCAAAGTTGAGGACCTTCTCCAAGCAG
TGAAGGCAACATTGCATAGTGCTCGATCAGCCTTGGAGACACCAGACGAGAAACAGCAAACTCAATCCTACCAGT
CCTTCCGCAGCGCCGTAATCTTTCGTGAAGAGAGTTTAAATAGTAAACACATCTCGCCATCACCAAATGTAAGAC
CCAAAACCCACCTGTTCATCAGCAACCGAAAGATAGAGACTTACCGCATATAGTTTGACCTCGAACTTCATGCCA
CAAATAGTAGAAATGGCATTGAGATCCACATGCTCTATACTCCGTCTACAGTATCTGAGGACCTTGCAGTCCATT
TGGCCGATACTCTCCATCGGACATTCGAATTGGTCAACAACCACTCAGAGACTGAGCTTTCGAGTGCAAGCTACT
TGGGCCCACTCAGCCATAAGAGGATTTTCAACTGGAATTCCAACGCGCCTAATGCGGTGATTGAGTGCGCTCATG
AGCTAGTTAGAAAGACAGCGTCCTTGCAACCACAGGCTCCTGCTATTGATTCATGGGATGCACAGATGACGTATG
CAGAGCTGGATTCTCTGTCAAACCATCTGGCTACGGTGTTGGTGGAACTGGGAATCAAGGCCGAGGTGATTGTGC
CTCTGTGTTTTGAAAAGTCTGCATGGTATGTCGTGGCGTTGCTTGCAGTACTCAAAGCCGGTGGTGCCTTTGTTC
CCCTCGACCCGACGCATCCCTCATCACGTCTACGAGAGATCGTCAGCCAAGTTGATGCACCGATTATTTTGACGA
CAGCCAAACATCACGATCTCTTCGATGACTTTTCTGTCAAGACAATGATAGTCAATGAAGACACAGTCGGGACAA
TAACTAGTGGTGACGGGTGTCTTACTCCAGTCACCGTCACGCCTGAGAATCTCGCATATGTGATCTTTACCTCTG
GGAGCACTGGAAAGCCCAAAGGTACGATGATCCAGCACCAGTCCTTCTGCAGTGGGTCTCTGCGACAGGGTGAAG
CGGCCAACATGGGACCTCATTCCCGGATATTCCAGTTCGCTTCATACAGCTTTGACGTGAGTATTTTGGAAATCC
TCACGGGCCTTATATTCGGCGCCTGCATCTGTATCCCGAACGAGCAGCTTGGTCGTGCAGACTTTGTCCAGTCCA
TGAATGACTTTCGTGTCAACTGGGCCTTCTTGACACCGTCGGTGTTGAAGGTGCTGACTCCTGATCAACTGCCGC
TTTTGAAGACTCTGGTACTGGGAGGCGAAGCTATGTCAGAGTCGGATATGATGACATGGGCGGGAAGGCTCCAGT
TGATGAATGGCTATGGGCCAAGTGAATGCTCCGTCGCAGCCACTGCCAATACTCAGCTCAACCCCCAGTCCAGCC
CACGGAATATTGGTAGAGCAATTGGTGGCGTATGCTGGATTGTTGATCCGCAAAACCACAACGTGCTTCTCCCTG
TTGGCGCCACAGGTGAGCTGATCATCCAAGGTCCTATTGTCTCGCGTGGATATATCAAGGATCCTGTGAAGACTT
CATCAGCCTTCTTTAGAAACCCGGCTTGGATGGTGCCGGGTACATCCTCAATCTGGAATCGCTTTTACAAGACTG
GTGATCTGGTACGATATGATGCGGACGGCATGATTCACTTCATTGGGCGTAAGGACCACCAAGTCAAGCTCAATG
GACAGCGTATGGAATTAGGGGAGGTAGAGCACCACCTCTGGACAGATCCAGTCATCCGTAACGGAATGGCTCTCA
TTCCCTACACTGGTCACTGCAAATCCCGCTTGGTTGGTATCGTGTCTCTCCACAAGCATTTTACAACCGCTTCAA
TACAGACACACACGAGTATTCGCCTGGTAAATCATGCCGAGGCCGCAGCAGACACCCAAGCGATTGCAGAAAGGC
TGTCACACCTGCTCCCCACGTATATGGTCCCAACCATCTGGATTGTCCTGGAGAGTCTTCCACTCATGTCGTCGG
GCAAGATGGACCGGAAGAAGGTTGGGGATTTTGTTGCTGATATGAGCACCGAGGCCTTCCAACACATCATAGGTA
ACTCAACAAAACCTGGCGACAAGGCGTCTTGGACCAAGACAGAGATTCTCGTGCAGAAGGTTTGGGCGAAAGCTC
TGAACGTACCAGAGGAGCAAATTGGCAAACACAGCAGCTTCCTGTCTGTGGGCGGTGACTCTATCAAAGCGATGG
CCGTCATGTCAGAGTTCCGCAAACTCGGAGTCACCGTCCTAGTAGCTGATCTGTTGCGGTACAATGTTACTGAGA
TCGCCTCTAAGCTGGAGGAGTCTGGCTCTGCGGATGTGCTCCGGAGAAGCGAGACAGATCACCTTCCCATATCAC
ACCTACAGCGCACCTTCCTCGAGGCGTCCCGTTCGGGCAACAGCGCCATACACCACGCCATGTTACTGGAACTCA
ATCACAAGATTAGTATCCAGCAGCTGAATGATGCCTTGGATAGTATCGTTTCTTCCTACCCAGCACTCACCCTCG
GCTTCAATGAGCAGAACGGGACATGGTTGCAAACATTCAGAGACCACGACGAGCTTGAAAACCCCGTTTACCACT
TGAATCTGAACCATGTCTCTAGCTTGGAAGAAGCACAAGAAATTATGCAGCATCGTCAGGCGTCAGTTGGTGTGA
GTGGTAACCCAAATCTCATGATCGATCTGTTCTCTCTTCGCGGCACACAGCACATTTCTCTCGTCGTGCATGCAG
CTATCCTTAATTCACAGTCTCTAAGTACTGTCATCGGCCATCTCGATTACTTGCTTCAGTCAAATGATGAAAAAG
AGGAAAACGTCTGGGAAAGTAAGCTTTTGTCCCGAGATGAGTTCTCTCATGCCTGGCTTGATCACCTCAGGAGCG
ATACTGGCATGGAGCCTATGAATGGTCCATTGCAATCTGTCGCCCTTGAATCTCTTAGTGGGTATCGAGACTATG
TCACAGAGACGCTAGAACTCGGCTCCGAGATTACTGGGCTTCTCACTGGACCGTGCAACCTAAAATTTGGCACCA
ACGCGGGGGATATATTTCTGGCGACCTTGATCCTGTCATACCACCAAATTCTAGAAGAAAATGACCACTCTACCT
TAGCTATTGTCGAAACAACCGCTACTGAGTCGACTCTTAGCAAACACTTGAGAGGTCATGTCGGTCAATTCTCTT
CGCTGCAACCCGTGCATGTGCCTGTGGAACACTCGGACCAAGTCACTCTTCAGCTAATCCGGGATACTAAGGACA
AAGTTCGCCAGAGGGGGATAGGTAGCAAGCTTGGCTCTTCCAATGTCATCTTCAACTACGGCTTGTCTAGCCGAC
TTACAGAAGGTATCGTGTTGAAGCAAGCCACCCTCACTCGGCGACACGGCTTGGGCGCCATCGTTCCCACAACTT
TCGAGGTTTCATGTCTGCTCGAAGATGGACAGTTCAGAATCACAGTCGGATCCGATCAGGTCAGCGCTCAGAAGC
TATTACTATTTACCGACCAGTACAGACAGAACATCACGCAAGCAGTCGAGATCCTCGCGTCCAATACAGCTAAGG
AATTCACTTTGGCGGACTTTCCATTGCTCAAACTCGATCATCCATCCCTTGAGAGAGTCAACCGTCAGCACCTTC
CACGAGTTGGCCTTAGACCAAATCAGATAGAAGATATGTATCCCTGCTCTCCGTTGCAGCAAGGTCTCCTTATGA
GCCAGGCTAGGAAGCAAGGCAGTTACAATGTATTCATTGGATGGGAGGTAGTCTCTTGCGGCGCAAACGACACAG
TTGATATTGGCAGATTGCTCTCCTCATGGCAAAAGGTAGTCGACCATCACCCTGCCCTGAGGACTATATTCACCG
ACGAATTTGGCGGCAAGGAGCCATACGCTCAAATTGTTCTGAGACGTCCCAGGGCGGAGGTTTCGGTGAAACCTT
GCTCAGATGTCGATGTTGCATCTGTGCTGGAGGAGACGATTGAACTAGGCACTAACCCTGTTGTCCCTCCACATC
GGTTCTCAATCAATGTCACAGCGGATGATAGAGTGTTCTGCCGAGTCGATGCTAGTCATACCATTGTCGATGGTG
TATCCAAGTCATTGATTCTAAGGGACCTGAAGCGAGCTTATGCGGGGACTCTTCTTTCTCCCACTGGAGGCGCTA
AGTACAGGGACTTCGTCCAATATGTTGCTGCAAACGACATGTCCGCTAGCATTTCTTTCTGGCAGAACCATCTTG
CCGAAGTCGAGCCCTGCTACTTTCCCAAATTAGCTGAGGCTGAAGGTACACCTGAGCTGAAGTACGTCCAGGTAG
AGCTAGGAATACCTACCAGTGTTCTGCGTGACTTCTGTGTCTCCCAGAGTATCACAATCTCGAACCTTCTACAGA
CAGTCTGGGCACTCGTCTGTCGGGTGTATGTCGGCCGAGATGATATTTGTTTCGGTTACTTGGCATCCGGAAGAG
ATGCACCTGTCGAAGACCTAGTCAACATGGTCGGGCCAACTATCAGTGTCCTCATTTGCAAGGCATTGCTGGAGG
ACTCCACTATTATCAAGGACGCCTTGAAGGCTTGCCAGGAAGAGTTCCTTGATTCTCTCGCACACCAGCAATGCT
CGCTCGCCGAGATTCAACATTCACTTGGACTCGCAGGAATGCCTCTGTTTAACACAGGCATTTCCTTCCAGACAA
TGACAGACGTTGATAGTGACGACGTTATCACCAATATTGACTTCGAGGGTCTCATTGTACGGGAGCCGACAGAGG
TATGACTTTACTCTGAACTACTTTGCAATAACTGACCTGAAGTAGTACAATATCACGGTTCACGTTGTCGATTCG
CCAAACAACGTGGACATCAAACTCGGATATTGGACTGATTGTATCTCAGAATCCCGAGCTGGATCCGTATCGGGA
ACATTCTCTGCCATCCTCAAATCCGTGGTCGAACATCCAGAGGCCCGAGTTGATCAGCTCAATGTTATCGGCCGG
TATGATTTGTCGCAGATTGTATCTTGGAATCAGGATGTGCCGGAGATTTCATCGTACACAGTACCGGACCTCGTG
CTCCAACAGATTACGCGTACCCCTCATGCTATTGCGATTGACACCATGGCCGAAAAGATAACCTATCAGGATTTT
GGACGGATGTGGCTGTCGTTGTCTCGATACTTGACCAGGCTTGGTATTGGCGCCGGGGATTACGTGCCTTTGACG
TTCGAAAAGTCAGCATGGGCTATCGTTGCCATGTTTGCTGTTCTGGGTACTGGAGCTGCGTTCGTCCCTCTGGAT
CCTAAAACCCCGGTGGAGCGCCTACGCGAGGCCTCTATTCAAACTGCTGCTAACGTTGTTCTTGCATCTCCGAAA
TATGCTTCAAACTGGAACGACCTTATTCCAACCATTGTCAGTGTTGACCAGGATCTCCTCGACAAGCTGAACGAA
GAACAAGACGATCTCGACCAAGGTGTCGTGAGAGCCCGCCCCCATCATGATGCCTACGTTATCTTCACTTCGGGC
AGCACAGGCAAGCCAAAAGGATGTGTTGTGCAGCATTCTGCATTCTGCTCTGGAGCCCTGGCTCAAGGAAAGCTT
GCCTGTCTGGGTCCCTCATCACGAGTACTGCAGTTTGCTTCCTACAGCTTCGACGTTAGTCTGCTGGAAATCATG
ACATCACTCATGTTTGGTGCATGCATTTGCGTGCCGGACGAAGACTTGAGCAAGGACATCAAGCACTGCATCAAC
GTGCTCAATATCAACTGGACATTCCTTACGCCATCTGTCCTTAAGCTTTTACAACCGTCCGATGTGCCCTCATTG
AAGACTTTGGTTCTTGGCGGCGAAGCTCTCTCAAAGGGTGACATTCTCAACTGGGCTGACAGGGTACAGCTGTAC
AACGGATACGGACCTAGTGAGTGCTCTGTGGCAGCAGCAGCTAACCCAGGATTGCAACCTACTACCGATCCAGCC
AACATTGGACATGCTGTTGGTGGTGTGCTCTGGATTGTTGATGCCAAGCAACCTTCGAAGCTACTTCCCATTGGT
GCTGTTGGTGAGCTCTTGATTTCAGGTCCAATTCTGGCGAGAGGCTACCTGGGTGATCCTGAGAAAACAGCAGCC
GCCTTTGTCAAACAGAAGAGCTTTGTTCCAGGATCTCACAAGCGTGAGCGGTATTACCGCACTGGTGATCTTGTG
CGATACAATGCAGATGGCACGATTCATTTCATCGGCAGAGCTGATGGGCAGGTGAAGATTCGCGGCCAGCGGGTT
GAATTGGGCGAGATCGAGTACAATATCGAGCGTGATGAGAATATCCACCAGGCACTCACTTTGCTCCCATCTCAG
GGCCCATTCAAGAAGCAGCTATTGGCCGTTGTTTCTTTCAAAGGCTTCGATCTCCCTGTTGAGGAGGGACGATTA
ACTCTCGTGCCGGAGGACAGGAGACCCAAGATTATGGCGGTCGTGACCAGAATCGCTAACACCATATCTGCAGCC
CTTCCGATTTACATGGTGCCGGCCCTGTGGGTACCAGTGAACGCGATCCCCTTGTTGCCTTCCGGAAAGCTGGAC
CGGAAGAAGGTCCGGCGATGGGTCGAGACCCTGGACGATGCCACATATGAGCAGATTGCCAACGTAGGATCCAAA
GCTAGCGGCCGCGGCCCGAGTACACCTGCCGAATTTGAGCTGAGACGCATTTGGGCCTCCGTGCTAAATCGACCC
GAAGAGCAAATCAGTATGGAGCGGTCCTTCCAAAGCCTTGGTGGCGATTCCATCTCCGCTATGCAGGTTATCGCC
CAGTGCCGTGATGCCAAGCTCTCGCTCGCAGTTAAGGATCTCATTCAGTGTCCCACTATCGCCGAACTGGCACCG
AGAGTGCGACCTTTGGACGAAGATGCTGAGCCAATGGAAGACGATATTGATGTTCCGTTTAATCTTTCTCCTCAG
CAGACCTGGGAGTTCGACCTGAAACAGCACTGCGATCTCAATCGTTACAACACTACGTTCCTGCTATCGGTTCAT
TCTGATTCCGACCTAAAACCGGTCGTGGATGCAACAGTAGAGCGTCATCCCATGCTCCGTGCTCGGTTCCAGCGC
GATGAATCGGGCCGCTGGATGCAGTATATTCCTCTTGACCGGTCCAATAGTCATCTGTACCAGGAGTTGGAAGTG
CCTGACTTGGAAGCTATTGAACCATACACTGCGCCCAACCAGTCTGGCTTCGATTTGCAGCGTGGTCCATTGATG
CGTGCGATTATTTTCAAGCTTCCGAACGGAGACCGGTACGTTGGACTTACTGTACACCACATGGTTATCGACACC
GTTTCATGGCGCATTCTTCTCCAAGATATGCAACAAGGCTTATCCACCGGGACAATCACCTCCCACCGTTCCGAC
TCATTTGCCTTGTGGTGCCGTAAACTCAAGGAGCACGCTGATGAGAAATGGACTCCCGAATATGTACTACCTTTC
TCGATTCCTGCTCCACTGTACGATTACTGGCAGATGGAGGAATCCATGAACCTTTTCGTGACCGAAACTATCCAG
GAGTTCTCTCTGGACACCAAGACAACCGCCCGCTTGATGGGAAATTGCAACCATCAGTACCAGACTAAGCCACTT
GACATCTTCTTGTCGGCGATCTTCCATGCCTTCAGCGCGACGTTCACTGACCGTCCCGTACCTGCGGTCTTTATC
TACAGTCATGGTCGGGATGAGTTTGGTGGAGATCTTGATGTATCTAACACTATCGGATGGTTTACCTCCTCCACT
CCGGTAGTGATAAACCCATCTGGAGATATTGTCGACGACCTGCAGGCTGTGCGAGATGCGCGCGCCAGTGTGCCA
GGCAATGGAGTTCCCTACTGGGCAACCCGCTGGCTGACCGACGATGGCCATGCCGCCTTTGAACATCACAGCCCC
TTCGAGTTGTCTATGAACTACCTTGGCCAGTATCAGCAGCTGGAGCGCGACGATTCGGTACTTCGTTATGTGGAT
GTGAAGAAGCCCAAGGCAACTGGATCTGGGTCCGGTCTCCTCCGCACCGCGCTGGTTGAGACGCAAGCCATTGTT
ATCGGTGACTCGCTGCAGATCAAGTTCGTTTATAACACGCGCATGGCCCGGCAGAAGCAGCTCCTCGACTGGCAG
GCCAAGGTGAAGGATTCGCTACTGGAGATTGCCAATCGCCTCGGAGATGGTGTTGAGACTGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail