Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|119440
Gene name
Locationscaffold_9:1528852..1529552
Strand-
Gene length (bp)700
Transcript length (bp)525
Coding sequence length (bp)525
Protein length (aa) 175

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 1.0E-08 41 155

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 8.64 3.31 13.97
Initials Initials knots 13.39 5.39 21.40
Pileal_Stipeal_center Stage I stipe center 50.15 25.83 74.48
Pileal_Stipeal_shell Stage I stipe shell 32.54 15.69 49.39
DIF_stipe_center Stage II stipe center 47.48 23.82 71.13
DIF_stipe_shell Stage II stipe shell 41.88 20.93 62.82
DIF_stipe_skin Stage II stipe skin 24.81 11.29 38.32
DIF_cap_skin Stage II cap skin 11.95 4.85 19.06
DIF_cap_tissue Stage II cap tissue 25.57 10.60 40.55
DIF_gill_tissue Stage II gill tissue 60.13 30.78 89.48
YFB_stipe_center Young fruiting body stipe center 14.11 5.96 22.27
YFB_stipe_shell Young fruiting body stipe shell 20.06 9.08 31.05
YFB_stipe_skin Young fruiting body stipe skin 12.05 4.93 19.17
YFB_cap_skin Young fruiting body cap skin 7.82 2.80 12.83
YFB_cap_tissue Young fruiting body cap tissue 18.55 8.34 28.76
YFB_gill_tissue Young fruiting body gill tissue 32.12 12.50 51.74
YFB_veil Young fruiting body veil 33.56 13.54 53.58

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.278478 no
Casing YFB_stipe_shell 0.027205 yes
Casing YFB_stipe_skin 0.542565 no
Casing YFB_cap_skin 0.900741 no
Casing YFB_cap_tissue 0.050706 no
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.368152 no
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.003765 yes
Casing DIF_cap_skin 0.554138 no
Casing DIF_cap_tissue 0.003765 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.001140 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.000613 yes
DIF_gill_tissue YFB_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_gill_tissue 0.100411 no
DIF_gill_tissue YFB_veil 0.114735 no
YFB_stipe_center YFB_stipe_shell 0.452131 no
YFB_stipe_center YFB_stipe_skin 0.811448 no
YFB_stipe_center YFB_cap_skin 0.187677 no
YFB_stipe_center YFB_cap_tissue 0.600363 no
YFB_stipe_center YFB_gill_tissue 0.033444 yes
YFB_stipe_center YFB_veil 0.017783 yes
YFB_stipe_shell YFB_stipe_skin 0.238109 no
YFB_stipe_shell YFB_cap_skin 0.016386 yes
YFB_stipe_shell YFB_cap_tissue 0.912356 no
YFB_stipe_shell YFB_gill_tissue 0.286505 no
YFB_stipe_shell YFB_veil 0.204470 no
YFB_stipe_skin YFB_cap_skin 0.400760 no
YFB_stipe_skin YFB_cap_tissue 0.348961 no
YFB_stipe_skin YFB_gill_tissue 0.010412 yes
YFB_stipe_skin YFB_veil 0.005302 yes
YFB_cap_skin YFB_cap_tissue 0.032978 yes
YFB_cap_skin YFB_gill_tissue 0.000613 yes
YFB_cap_skin YFB_veil 0.000613 yes
YFB_cap_tissue YFB_gill_tissue 0.190974 no
YFB_cap_tissue YFB_veil 0.132420 no
YFB_gill_tissue YFB_veil 0.954745 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.945819 no
Initials YFB_stipe_shell 0.388312 no
Initials YFB_stipe_skin 0.885833 no
Initials YFB_cap_skin 0.260698 no
Initials YFB_cap_tissue 0.524822 no
Initials YFB_gill_tissue 0.027698 yes
Initials YFB_veil 0.015242 yes
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.017783 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.129827 no
Initials DIF_cap_skin 0.875706 no
Initials DIF_cap_tissue 0.117635 no
Pileal_Stipeal_center DIF_gill_tissue 0.724552 no
Pileal_Stipeal_center YFB_stipe_center 0.000613 yes
Pileal_Stipeal_center YFB_stipe_shell 0.007782 yes
Pileal_Stipeal_center YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.001140 yes
Pileal_Stipeal_center YFB_gill_tissue 0.293872 no
Pileal_Stipeal_center YFB_veil 0.338598 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.271949 no
Pileal_Stipeal_center DIF_stipe_center 0.933019 no
Pileal_Stipeal_center DIF_stipe_shell 0.727377 no
Pileal_Stipeal_center DIF_stipe_skin 0.040501 yes
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.063376 no
Pileal_Stipeal_shell DIF_gill_tissue 0.078944 no
Pileal_Stipeal_shell YFB_stipe_center 0.021583 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.230996 no
Pileal_Stipeal_shell YFB_stipe_skin 0.006032 yes
Pileal_Stipeal_shell YFB_cap_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.145929 no
Pileal_Stipeal_shell YFB_gill_tissue 0.985861 no
Pileal_Stipeal_shell YFB_veil 0.965501 no
Pileal_Stipeal_shell DIF_stipe_center 0.364251 no
Pileal_Stipeal_shell DIF_stipe_shell 0.598975 no
Pileal_Stipeal_shell DIF_stipe_skin 0.577853 no
Pileal_Stipeal_shell DIF_cap_skin 0.007782 yes
Pileal_Stipeal_shell DIF_cap_tissue 0.646900 no
DIF_stipe_center DIF_gill_tissue 0.621124 no
DIF_stipe_center YFB_stipe_center 0.000613 yes
DIF_stipe_center YFB_stipe_shell 0.011968 yes
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.005302 yes
DIF_stipe_center YFB_gill_tissue 0.381102 no
DIF_stipe_center YFB_veil 0.439304 no
DIF_stipe_center DIF_stipe_shell 0.829521 no
DIF_stipe_center DIF_stipe_skin 0.067706 no
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.100411 no
DIF_stipe_shell DIF_gill_tissue 0.376239 no
DIF_stipe_shell YFB_stipe_center 0.001625 yes
DIF_stipe_shell YFB_stipe_shell 0.034837 yes
DIF_stipe_shell YFB_stipe_skin 0.000613 yes
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.016104 yes
DIF_stipe_shell YFB_gill_tissue 0.604397 no
DIF_stipe_shell YFB_veil 0.675935 no
DIF_stipe_shell DIF_stipe_skin 0.161040 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.215507 no
DIF_stipe_skin DIF_gill_tissue 0.009123 yes
DIF_stipe_skin YFB_stipe_center 0.159459 no
DIF_stipe_skin YFB_stipe_shell 0.692158 no
DIF_stipe_skin YFB_stipe_skin 0.069013 no
DIF_stipe_skin YFB_cap_skin 0.002951 yes
DIF_stipe_skin YFB_cap_tissue 0.552410 no
DIF_stipe_skin YFB_gill_tissue 0.628586 no
DIF_stipe_skin YFB_veil 0.534439 no
DIF_stipe_skin DIF_cap_skin 0.066956 no
DIF_stipe_skin DIF_cap_tissue 0.967442 no
DIF_cap_skin DIF_gill_tissue 0.000613 yes
DIF_cap_skin YFB_stipe_center 0.797342 no
DIF_cap_skin YFB_stipe_shell 0.227479 no
DIF_cap_skin YFB_stipe_skin 0.991610 no
DIF_cap_skin YFB_cap_skin 0.407665 no
DIF_cap_skin YFB_cap_tissue 0.329846 no
DIF_cap_skin YFB_gill_tissue 0.010412 yes
DIF_cap_skin YFB_veil 0.003365 yes
DIF_cap_skin DIF_cap_tissue 0.050085 no
DIF_cap_tissue DIF_gill_tissue 0.012577 yes
DIF_cap_tissue YFB_stipe_center 0.146995 no
DIF_cap_tissue YFB_stipe_shell 0.654742 no
DIF_cap_tissue YFB_stipe_skin 0.056958 no
DIF_cap_tissue YFB_cap_skin 0.002951 yes
DIF_cap_tissue YFB_cap_tissue 0.518737 no
DIF_cap_tissue YFB_gill_tissue 0.699220 no
DIF_cap_tissue YFB_veil 0.611662 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|119440
MFQGLNQLIVLATLLSTGLGGFAIPSRRQAGLSVIKATELDPNVCADAGAGTVGTRVQFNPCNGGSSQLWMLDSA
GAEQGLVFIRPLSDSSLCAGIIGGNNVVTLLDAADCASNTDTTNWFPGDSETPAVGFLDGTCLTVDNNEGDSHPA
RVQSCIVNFDFTNTAGRQHIVISN*
Coding >AgabiH97|119440
ATGTTCCAAGGTTTAAACCAACTTATTGTTCTTGCCACTCTCCTTTCTACCGGGCTTGGAGGATTTGCCATTCCT
TCCCGCAGACAGGCCGGTCTTTCCGTGATCAAGGCTACAGAACTCGATCCGAATGTATGTGCTGATGCCGGTGCT
GGAACAGTTGGCACTCGGGTGCAGTTCAATCCCTGCAATGGGGGTAGTAGCCAGCTGTGGATGCTGGACTCAGCA
GGTGCCGAACAAGGCTTAGTCTTCATAAGGCCACTTTCGGACAGTTCGTTGTGTGCCGGCATCATTGGCGGTAAT
AACGTCGTCACATTGCTGGACGCGGCTGATTGTGCTTCTAACACTGACACCACCAATTGGTTCCCTGGGGATTCC
GAAACTCCCGCAGTTGGTTTCCTTGATGGCACTTGTTTGACGGTGGACAACAACGAGGGCGACAGCCATCCTGCC
AGAGTTCAAAGCTGTATTGTAAATTTCGATTTCACCAATACCGCAGGAAGGCAACACATTGTGATTTCCAATTAA
Transcript >AgabiH97|119440
ATGTTCCAAGGTTTAAACCAACTTATTGTTCTTGCCACTCTCCTTTCTACCGGGCTTGGAGGATTTGCCATTCCT
TCCCGCAGACAGGCCGGTCTTTCCGTGATCAAGGCTACAGAACTCGATCCGAATGTATGTGCTGATGCCGGTGCT
GGAACAGTTGGCACTCGGGTGCAGTTCAATCCCTGCAATGGGGGTAGTAGCCAGCTGTGGATGCTGGACTCAGCA
GGTGCCGAACAAGGCTTAGTCTTCATAAGGCCACTTTCGGACAGTTCGTTGTGTGCCGGCATCATTGGCGGTAAT
AACGTCGTCACATTGCTGGACGCGGCTGATTGTGCTTCTAACACTGACACCACCAATTGGTTCCCTGGGGATTCC
GAAACTCCCGCAGTTGGTTTCCTTGATGGCACTTGTTTGACGGTGGACAACAACGAGGGCGACAGCCATCCTGCC
AGAGTTCAAAGCTGTATTGTAAATTTCGATTTCACCAATACCGCAGGAAGGCAACACATTGTGATTTCCAATTAA
Gene >AgabiH97|119440
ATGTTCCAAGGTTTAAACCAACTTATTGTTCTTGCCACTCTCCTTTCTACCGGGCTTGGAGGATTTGCCATTCCT
TCCCGCAGACAGGCCGGTCTTTCCGTGATCAAGGCTACAGAACTCGATCCGAATGTATGTGCTGATGCCGGTGCT
GGAACAGTTGGCACTCGGGTGCAGTTGTACGTCGAATTTTTCTTCGACGTTTCTTTTATTCACACTTATTTCACA
CTACTTAGCAATCCCTGCAATGGGGGTAGTAGCCAGCTGTGGATGCTGGACTCAGCAGGTGCCGAACAAGGCTTA
GTCTTCATAAGGCCACTTTCGGACAGTTCGTTGTGTGCCGGCATCATTGGCGGTAGTGAGTTTACACCACCCGAG
CTCGTTAAACTATTGTAGGAGTCGGCTTACAATTGAACCAGATAACGTCGTCACATTGCTGGACGCGGCTGATTG
TGCTTCTAACACTGACACCACCAATTGGTTCCCTGGGGATTCCGAAACTCCCGCAGTTGGTTTCCTTGATGGCAG
TTCGTCGCTACATCTTCCTTCCCAAATAACGTGGTTGCTAACCTGAGGGTAAACAGCTTGTTTGACGGTGGACAA
CAACGAGGGCGACAGCCATCCTGCCAGAGTTCAAAGCTGTATTGTAAATTTCGATTTCACCAATACCGCAGGAAG
GCAACACATTGTGATTTCCAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail