© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|119440 |
| Gene name | |
| Location | scaffold_9:1528852..1529552 |
| Strand | - |
| Gene length (bp) | 700 |
| Transcript length (bp) | 525 |
| Coding sequence length (bp) | 525 |
| Protein length (aa) | 175 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00652 | Ricin_B_lectin | Ricin-type beta-trefoil lectin domain | 1.0E-08 | 41 | 155 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 24 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 8.64 | 3.31 | 13.97 |
| Initials | Initials knots | 13.39 | 5.39 | 21.40 |
| Pileal_Stipeal_center | Stage I stipe center | 50.15 | 25.83 | 74.48 |
| Pileal_Stipeal_shell | Stage I stipe shell | 32.54 | 15.69 | 49.39 |
| DIF_stipe_center | Stage II stipe center | 47.48 | 23.82 | 71.13 |
| DIF_stipe_shell | Stage II stipe shell | 41.88 | 20.93 | 62.82 |
| DIF_stipe_skin | Stage II stipe skin | 24.81 | 11.29 | 38.32 |
| DIF_cap_skin | Stage II cap skin | 11.95 | 4.85 | 19.06 |
| DIF_cap_tissue | Stage II cap tissue | 25.57 | 10.60 | 40.55 |
| DIF_gill_tissue | Stage II gill tissue | 60.13 | 30.78 | 89.48 |
| YFB_stipe_center | Young fruiting body stipe center | 14.11 | 5.96 | 22.27 |
| YFB_stipe_shell | Young fruiting body stipe shell | 20.06 | 9.08 | 31.05 |
| YFB_stipe_skin | Young fruiting body stipe skin | 12.05 | 4.93 | 19.17 |
| YFB_cap_skin | Young fruiting body cap skin | 7.82 | 2.80 | 12.83 |
| YFB_cap_tissue | Young fruiting body cap tissue | 18.55 | 8.34 | 28.76 |
| YFB_gill_tissue | Young fruiting body gill tissue | 32.12 | 12.50 | 51.74 |
| YFB_veil | Young fruiting body veil | 33.56 | 13.54 | 53.58 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.000613 | yes |
| Casing | YFB_stipe_center | 0.278478 | no |
| Casing | YFB_stipe_shell | 0.027205 | yes |
| Casing | YFB_stipe_skin | 0.542565 | no |
| Casing | YFB_cap_skin | 0.900741 | no |
| Casing | YFB_cap_tissue | 0.050706 | no |
| Casing | YFB_gill_tissue | 0.000613 | yes |
| Casing | YFB_veil | 0.000613 | yes |
| Casing | Initials | 0.368152 | no |
| Casing | Pileal_Stipeal_center | 0.000613 | yes |
| Casing | Pileal_Stipeal_shell | 0.000613 | yes |
| Casing | DIF_stipe_center | 0.000613 | yes |
| Casing | DIF_stipe_shell | 0.000613 | yes |
| Casing | DIF_stipe_skin | 0.003765 | yes |
| Casing | DIF_cap_skin | 0.554138 | no |
| Casing | DIF_cap_tissue | 0.003765 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.001140 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_gill_tissue | 0.100411 | no |
| DIF_gill_tissue | YFB_veil | 0.114735 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.452131 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.811448 | no |
| YFB_stipe_center | YFB_cap_skin | 0.187677 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.600363 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.033444 | yes |
| YFB_stipe_center | YFB_veil | 0.017783 | yes |
| YFB_stipe_shell | YFB_stipe_skin | 0.238109 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.016386 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.912356 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.286505 | no |
| YFB_stipe_shell | YFB_veil | 0.204470 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.400760 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.348961 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.010412 | yes |
| YFB_stipe_skin | YFB_veil | 0.005302 | yes |
| YFB_cap_skin | YFB_cap_tissue | 0.032978 | yes |
| YFB_cap_skin | YFB_gill_tissue | 0.000613 | yes |
| YFB_cap_skin | YFB_veil | 0.000613 | yes |
| YFB_cap_tissue | YFB_gill_tissue | 0.190974 | no |
| YFB_cap_tissue | YFB_veil | 0.132420 | no |
| YFB_gill_tissue | YFB_veil | 0.954745 | no |
| Initials | DIF_gill_tissue | 0.000613 | yes |
| Initials | YFB_stipe_center | 0.945819 | no |
| Initials | YFB_stipe_shell | 0.388312 | no |
| Initials | YFB_stipe_skin | 0.885833 | no |
| Initials | YFB_cap_skin | 0.260698 | no |
| Initials | YFB_cap_tissue | 0.524822 | no |
| Initials | YFB_gill_tissue | 0.027698 | yes |
| Initials | YFB_veil | 0.015242 | yes |
| Initials | Pileal_Stipeal_center | 0.000613 | yes |
| Initials | Pileal_Stipeal_shell | 0.017783 | yes |
| Initials | DIF_stipe_center | 0.000613 | yes |
| Initials | DIF_stipe_shell | 0.000613 | yes |
| Initials | DIF_stipe_skin | 0.129827 | no |
| Initials | DIF_cap_skin | 0.875706 | no |
| Initials | DIF_cap_tissue | 0.117635 | no |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.724552 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.007782 | yes |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.001140 | yes |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.293872 | no |
| Pileal_Stipeal_center | YFB_veil | 0.338598 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.271949 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.933019 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.727377 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.040501 | yes |
| Pileal_Stipeal_center | DIF_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.063376 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.078944 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.021583 | yes |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.230996 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.006032 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.145929 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.985861 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.965501 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.364251 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.598975 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.577853 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.007782 | yes |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.646900 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.621124 | no |
| DIF_stipe_center | YFB_stipe_center | 0.000613 | yes |
| DIF_stipe_center | YFB_stipe_shell | 0.011968 | yes |
| DIF_stipe_center | YFB_stipe_skin | 0.000613 | yes |
| DIF_stipe_center | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_center | YFB_cap_tissue | 0.005302 | yes |
| DIF_stipe_center | YFB_gill_tissue | 0.381102 | no |
| DIF_stipe_center | YFB_veil | 0.439304 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.829521 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.067706 | no |
| DIF_stipe_center | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_center | DIF_cap_tissue | 0.100411 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.376239 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.001625 | yes |
| DIF_stipe_shell | YFB_stipe_shell | 0.034837 | yes |
| DIF_stipe_shell | YFB_stipe_skin | 0.000613 | yes |
| DIF_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.016104 | yes |
| DIF_stipe_shell | YFB_gill_tissue | 0.604397 | no |
| DIF_stipe_shell | YFB_veil | 0.675935 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.161040 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | DIF_cap_tissue | 0.215507 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.009123 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.159459 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.692158 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.069013 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.002951 | yes |
| DIF_stipe_skin | YFB_cap_tissue | 0.552410 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.628586 | no |
| DIF_stipe_skin | YFB_veil | 0.534439 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.066956 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.967442 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_center | 0.797342 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.227479 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.991610 | no |
| DIF_cap_skin | YFB_cap_skin | 0.407665 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.329846 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.010412 | yes |
| DIF_cap_skin | YFB_veil | 0.003365 | yes |
| DIF_cap_skin | DIF_cap_tissue | 0.050085 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.012577 | yes |
| DIF_cap_tissue | YFB_stipe_center | 0.146995 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.654742 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.056958 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.002951 | yes |
| DIF_cap_tissue | YFB_cap_tissue | 0.518737 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.699220 | no |
| DIF_cap_tissue | YFB_veil | 0.611662 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|119440 MFQGLNQLIVLATLLSTGLGGFAIPSRRQAGLSVIKATELDPNVCADAGAGTVGTRVQFNPCNGGSSQLWMLDSA GAEQGLVFIRPLSDSSLCAGIIGGNNVVTLLDAADCASNTDTTNWFPGDSETPAVGFLDGTCLTVDNNEGDSHPA RVQSCIVNFDFTNTAGRQHIVISN* |
| Coding | >AgabiH97|119440 ATGTTCCAAGGTTTAAACCAACTTATTGTTCTTGCCACTCTCCTTTCTACCGGGCTTGGAGGATTTGCCATTCCT TCCCGCAGACAGGCCGGTCTTTCCGTGATCAAGGCTACAGAACTCGATCCGAATGTATGTGCTGATGCCGGTGCT GGAACAGTTGGCACTCGGGTGCAGTTCAATCCCTGCAATGGGGGTAGTAGCCAGCTGTGGATGCTGGACTCAGCA GGTGCCGAACAAGGCTTAGTCTTCATAAGGCCACTTTCGGACAGTTCGTTGTGTGCCGGCATCATTGGCGGTAAT AACGTCGTCACATTGCTGGACGCGGCTGATTGTGCTTCTAACACTGACACCACCAATTGGTTCCCTGGGGATTCC GAAACTCCCGCAGTTGGTTTCCTTGATGGCACTTGTTTGACGGTGGACAACAACGAGGGCGACAGCCATCCTGCC AGAGTTCAAAGCTGTATTGTAAATTTCGATTTCACCAATACCGCAGGAAGGCAACACATTGTGATTTCCAATTAA |
| Transcript | >AgabiH97|119440 ATGTTCCAAGGTTTAAACCAACTTATTGTTCTTGCCACTCTCCTTTCTACCGGGCTTGGAGGATTTGCCATTCCT TCCCGCAGACAGGCCGGTCTTTCCGTGATCAAGGCTACAGAACTCGATCCGAATGTATGTGCTGATGCCGGTGCT GGAACAGTTGGCACTCGGGTGCAGTTCAATCCCTGCAATGGGGGTAGTAGCCAGCTGTGGATGCTGGACTCAGCA GGTGCCGAACAAGGCTTAGTCTTCATAAGGCCACTTTCGGACAGTTCGTTGTGTGCCGGCATCATTGGCGGTAAT AACGTCGTCACATTGCTGGACGCGGCTGATTGTGCTTCTAACACTGACACCACCAATTGGTTCCCTGGGGATTCC GAAACTCCCGCAGTTGGTTTCCTTGATGGCACTTGTTTGACGGTGGACAACAACGAGGGCGACAGCCATCCTGCC AGAGTTCAAAGCTGTATTGTAAATTTCGATTTCACCAATACCGCAGGAAGGCAACACATTGTGATTTCCAATTAA |
| Gene | >AgabiH97|119440 ATGTTCCAAGGTTTAAACCAACTTATTGTTCTTGCCACTCTCCTTTCTACCGGGCTTGGAGGATTTGCCATTCCT TCCCGCAGACAGGCCGGTCTTTCCGTGATCAAGGCTACAGAACTCGATCCGAATGTATGTGCTGATGCCGGTGCT GGAACAGTTGGCACTCGGGTGCAGTTGTACGTCGAATTTTTCTTCGACGTTTCTTTTATTCACACTTATTTCACA CTACTTAGCAATCCCTGCAATGGGGGTAGTAGCCAGCTGTGGATGCTGGACTCAGCAGGTGCCGAACAAGGCTTA GTCTTCATAAGGCCACTTTCGGACAGTTCGTTGTGTGCCGGCATCATTGGCGGTAGTGAGTTTACACCACCCGAG CTCGTTAAACTATTGTAGGAGTCGGCTTACAATTGAACCAGATAACGTCGTCACATTGCTGGACGCGGCTGATTG TGCTTCTAACACTGACACCACCAATTGGTTCCCTGGGGATTCCGAAACTCCCGCAGTTGGTTTCCTTGATGGCAG TTCGTCGCTACATCTTCCTTCCCAAATAACGTGGTTGCTAACCTGAGGGTAAACAGCTTGTTTGACGGTGGACAA CAACGAGGGCGACAGCCATCCTGCCAGAGTTCAAAGCTGTATTGTAAATTTCGATTTCACCAATACCGCAGGAAG GCAACACATTGTGATTTCCAATTAA |