Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|119220
Gene name
Locationscaffold_9:1474450..1476873
Strand-
Gene length (bp)2423
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.1E-10 42 388

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 11 558 2.0E-115
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 6 555 1.0E-93
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 3 559 2.0E-80
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 42 517 5.0E-79
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 31 560 4.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 11 558 2.0E-115
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 6 555 1.0E-93
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 3 559 2.0E-80
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 42 517 5.0E-79
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 31 560 4.0E-78
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 15 562 1.0E-72
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 11 533 2.0E-69
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 5 554 2.0E-68
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 26 543 7.0E-62
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 26 543 3.0E-61
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 11 530 5.0E-58
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 15 559 3.0E-52
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 36 557 8.0E-25
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 28 546 1.0E-13
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 28 546 1.0E-12
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 28 464 2.0E-12
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 80 525 3.0E-10
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 122 464 2.0E-09
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 57 315 3.0E-08
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 16 193 4.0E-06
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 125 549 7.0E-06
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 125 549 7.0E-06
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 84 363 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 28 50 22
2 65 87 22
3 94 113 19
4 117 139 22
5 151 173 22
6 183 205 22
7 235 257 22
8 267 286 19
9 306 328 22
10 343 365 22
11 372 391 19
12 401 423 22
13 436 458 22
14 514 536 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|119220
MVSFDDAANLGVRTIEATHKVNGKYYKWFLFAGLGLSAYVYSLDGTTTYNYLAFATSSFGHHSLISTIQVAQSII
IAVGKPVIAKFADVRSRGSAYLLALIFYAIGYIVIASAGNTATIAGGIIIYAVGYTGLQLLMQIIIADITTLKWR
GLVSSLVSTPFIINAFVGSNISTSILTHSTWRWGYGMFAILVPAALSPLIVTLLWAERRARKSGLITKPDSLPFI
RAVMDFTDRLDLFGLVLLGISVTLILLPLTLSQTAEGHWRNASIIAMIIIGGCLLPFFAFWEVKFARYPVIPKRF
LSNRTIVLAAFIGAFDFISFYLTYTYLFSFILVVKPWTLLNATYFSQTQSVALTFFGILCGLMMRFVHRYKYILS
IGLTIRLIGCGLMIHSRGANASDAEIVWSQLLQGIGGGIAAVASQVGAQASVTHSDVAMATAVVLLITEIGGSIG
SSIAGALWMNIMPARMAKHLPFLSQNEQAELFGSIVSVTQYPRGNPIREGVIQAYDDVMRTMTITATVIAVIPLL
LSLFMTNYYLGDSQNAVEQNDLRDMDSREGDKDNYPIDLDTTVAKK*
Coding >AgabiH97|119220
ATGGTGTCCTTTGACGATGCTGCAAATCTTGGTGTTCGTACCATTGAGGCTACTCACAAGGTCAACGGCAAATAC
TACAAATGGTTCCTTTTTGCTGGGTTAGGTCTCTCCGCCTATGTATACTCCCTGGACGGAACCACGACATACAAC
TACCTTGCCTTTGCGACCTCGAGTTTTGGCCATCACAGTCTCATTAGCACGATACAGGTCGCACAGTCTATTATC
ATTGCTGTTGGTAAACCCGTCATTGCAAAATTTGCCGATGTTCGTTCGCGTGGTTCAGCATATCTTTTGGCCTTG
ATCTTCTATGCTATTGGATACATTGTTATCGCTTCGGCGGGAAATACGGCGACGATAGCCGGGGGAATCATCATA
TATGCAGTAGGATATACAGGACTACAATTGCTCATGCAGATTATCATCGCTGACATTACGACTCTCAAATGGCGA
GGATTAGTATCAAGTCTCGTGTCTACACCTTTCATCATCAACGCGTTCGTCGGCTCCAATATCTCTACCAGTATA
CTTACTCACTCGACTTGGAGATGGGGGTACGGCATGTTCGCCATTCTTGTACCTGCCGCTCTCTCGCCACTTATT
GTCACACTTCTCTGGGCTGAGCGTCGCGCAAGAAAATCTGGTCTAATAACCAAACCGGATTCCTTACCCTTCATA
CGCGCGGTAATGGATTTTACTGATCGTCTCGACCTTTTTGGTCTAGTTCTTCTTGGTATTTCCGTTACACTTATT
CTGTTACCCCTCACTTTATCTCAGACTGCTGAGGGGCATTGGAGAAACGCTTCCATAATTGCCATGATAATCATC
GGTGGTTGTCTCTTACCCTTTTTCGCATTCTGGGAAGTCAAGTTTGCACGATATCCTGTGATCCCCAAGCGGTTT
TTATCCAATCGAACTATAGTTCTTGCTGCCTTCATTGGTGCTTTTGATTTTATTTCTTTTTATCTTACATATACC
TATCTTTTTTCTTTCATCCTCGTTGTGAAACCATGGACTCTTCTCAACGCCACGTATTTCTCGCAAACACAGAGT
GTAGCATTAACATTCTTCGGGATTCTCTGTGGCCTTATGATGCGCTTCGTTCATCGATACAAGTATATTCTTTCC
ATAGGTCTTACTATCCGGCTTATCGGCTGCGGCCTCATGATCCACTCTCGAGGTGCAAACGCTTCAGATGCCGAA
ATTGTATGGTCGCAGCTCCTTCAAGGTATCGGTGGAGGAATCGCCGCTGTCGCATCCCAAGTTGGTGCACAAGCA
TCAGTGACTCATTCCGACGTTGCGATGGCAACTGCTGTTGTTTTGCTTATCACCGAGATTGGTGGTAGTATCGGA
AGCTCCATCGCTGGTGCGCTGTGGATGAACATAATGCCTGCGAGAATGGCGAAACATCTTCCGTTCCTTTCACAG
AATGAACAAGCTGAGCTCTTTGGTTCAATTGTTAGTGTGACTCAATATCCTCGTGGCAATCCAATACGAGAAGGT
GTCATTCAAGCCTATGATGATGTCATGCGAACGATGACTATTACTGCCACCGTCATTGCAGTCATCCCTCTCCTA
CTTTCATTGTTCATGACGAATTACTACCTTGGCGATTCTCAGAATGCGGTTGAACAAAATGATCTCCGGGATATG
GATTCCCGTGAAGGAGATAAAGATAATTATCCCATTGATTTGGATACAACTGTAGCCAAGAAATAA
Transcript >AgabiH97|119220
ATGGTGTCCTTTGACGATGCTGCAAATCTTGGTGTTCGTACCATTGAGGCTACTCACAAGGTCAACGGCAAATAC
TACAAATGGTTCCTTTTTGCTGGGTTAGGTCTCTCCGCCTATGTATACTCCCTGGACGGAACCACGACATACAAC
TACCTTGCCTTTGCGACCTCGAGTTTTGGCCATCACAGTCTCATTAGCACGATACAGGTCGCACAGTCTATTATC
ATTGCTGTTGGTAAACCCGTCATTGCAAAATTTGCCGATGTTCGTTCGCGTGGTTCAGCATATCTTTTGGCCTTG
ATCTTCTATGCTATTGGATACATTGTTATCGCTTCGGCGGGAAATACGGCGACGATAGCCGGGGGAATCATCATA
TATGCAGTAGGATATACAGGACTACAATTGCTCATGCAGATTATCATCGCTGACATTACGACTCTCAAATGGCGA
GGATTAGTATCAAGTCTCGTGTCTACACCTTTCATCATCAACGCGTTCGTCGGCTCCAATATCTCTACCAGTATA
CTTACTCACTCGACTTGGAGATGGGGGTACGGCATGTTCGCCATTCTTGTACCTGCCGCTCTCTCGCCACTTATT
GTCACACTTCTCTGGGCTGAGCGTCGCGCAAGAAAATCTGGTCTAATAACCAAACCGGATTCCTTACCCTTCATA
CGCGCGGTAATGGATTTTACTGATCGTCTCGACCTTTTTGGTCTAGTTCTTCTTGGTATTTCCGTTACACTTATT
CTGTTACCCCTCACTTTATCTCAGACTGCTGAGGGGCATTGGAGAAACGCTTCCATAATTGCCATGATAATCATC
GGTGGTTGTCTCTTACCCTTTTTCGCATTCTGGGAAGTCAAGTTTGCACGATATCCTGTGATCCCCAAGCGGTTT
TTATCCAATCGAACTATAGTTCTTGCTGCCTTCATTGGTGCTTTTGATTTTATTTCTTTTTATCTTACATATACC
TATCTTTTTTCTTTCATCCTCGTTGTGAAACCATGGACTCTTCTCAACGCCACGTATTTCTCGCAAACACAGAGT
GTAGCATTAACATTCTTCGGGATTCTCTGTGGCCTTATGATGCGCTTCGTTCATCGATACAAGTATATTCTTTCC
ATAGGTCTTACTATCCGGCTTATCGGCTGCGGCCTCATGATCCACTCTCGAGGTGCAAACGCTTCAGATGCCGAA
ATTGTATGGTCGCAGCTCCTTCAAGGTATCGGTGGAGGAATCGCCGCTGTCGCATCCCAAGTTGGTGCACAAGCA
TCAGTGACTCATTCCGACGTTGCGATGGCAACTGCTGTTGTTTTGCTTATCACCGAGATTGGTGGTAGTATCGGA
AGCTCCATCGCTGGTGCGCTGTGGATGAACATAATGCCTGCGAGAATGGCGAAACATCTTCCGTTCCTTTCACAG
AATGAACAAGCTGAGCTCTTTGGTTCAATTGTTAGTGTGACTCAATATCCTCGTGGCAATCCAATACGAGAAGGT
GTCATTCAAGCCTATGATGATGTCATGCGAACGATGACTATTACTGCCACCGTCATTGCAGTCATCCCTCTCCTA
CTTTCATTGTTCATGACGAATTACTACCTTGGCGATTCTCAGAATGCGGTTGAACAAAATGATCTCCGGGATATG
GATTCCCGTGAAGGAGATAAAGATAATTATCCCATTGATTTGGATACAACTGTAGCCAAGAAATAA
Gene >AgabiH97|119220
ATGGTGTCCTTTGACGATGCTGCAAATCTTGGTGTTCGTACCATTGAGGCTACTCACAAGGTCAACGGCAAATAC
TACAAATGGTTCCTTTTTGCTGGGTGAAAACTTCAAGTACCGTTCGTAGAGTCATCTACTGATAATTCCGCTCAG
GTTAGGTCTCTCCGCCTATGTATACTCCCTGGACGGAACCACGACATACAACTACCTTGCCTTTGCGACCTCGAG
TTTTGGCCATCACAGTCTCATTAGCACGATACAGGTCGCACAGTCTATTATCAGTGCGTCTAATGAATCCACAAT
ATACCCTTCCTAAAATTTTTGCAGTTGCTGTTGGTAAACCCGTCATTGCAAAATTTGCCGATGTTCGTTCGCGTG
GTTCAGCATATCTTTTGGCCTGTCAGTTATCTCTATGTTTGCGGTTTCCTGATACCCCGGGCGTACTGAAACGTG
TCTTTCTTAGTGATCTTCTATGCTATTGGTATATACTTTAAATATCAGTCCAACTGTTTGGCTAACTTAGACCAG
GATACATTGTTATCGCTTCGGCGGGAAATACGGCGACGATAGCCGGGGGAATCATCATATATGCAGTGTATGTCT
ATTTGTTTGTCGTGTGGGAAGCTTATTGACATTGTGATGTGCGCCCTAGAGGATATACGTTAGTTGTCAATCAAT
TTCATGACGAAACTCTCACCCACTTCACTATTGTAGAGGACTACAATTGCTCATGCAGATTATCATCGCTGACAT
TACGACTCTCAAATGGCGAGGATTAGTATCAAGTCTCGTGTCTACACCTTTCATCATCAACGCGTTCGTCGGCTC
CAATATCTCTACCAGTATACTTACTCACTCGACTTGGAGATGGGGGTGTGAGCAATAATGCACTTCATCGACTCC
CTCATCAAAACTGATATAATTTTTTCTAGACGGCATGTTCGCCATTCTTGTACCTGCCGCTCTCTCGCCACTTAT
TGTCACACTTCTCTGGGCTGAGCGTCGCGCAAGAAAATCTGGTCTAATAACCAAACCGGATTCCTTACCCTTCAT
ACGCGCGGTAATGGATTTTACTGATCGTCTCGACCTTTTTGGTCTAGTTCTTCTTGGTATTTCCGTTACACTTAT
TCTGTTACCCCTCACTTTATCTCAGACTGCTGAGGGGCATTGGAGAAACGGTGTGTCTGCTTTTCTGCAATGTTT
GTAAATATCACACTTATAAGTTTGTGTTCATAGCTTCCATAATTGCCATGATAATCATCGGTGGTTGTCTCTTAC
CCTTTTTCGCATTCTGGGAAGTCAAGTTTGCACGATATCCTGTGATCCCCAAGCGGTTTTTATCCAATCGAACTA
TAGTTCTTGCTGCCTTCATTGGTGCTTTTGATTTTGTGAGATCCCTGCATCCTATGGTTGACGATTCAGTATGAA
CAAGAATACGTTCGCAGATTTCTTTTTATCTTACATATACCTATCTTTTTTCTTTCATCCTCGTTGTGAAACCAT
GGTGAGTGTCATATACTCTATGTGTGATCGAGTCTCAAGGAGTTTTGTCTTCAGGACTCTTCTCAACGCCACGTA
TTTCTCGCAAACACAGAGTGTAGCATTAACATTCTTCGGGATTCTCTGTGGCCTTATGATGCGCTTCGTTCATCG
ATACAAGGTGCATCCCGACGAATTCCCTTCTTCGTCGAAGCTAATATACATCACATATGCAGTATATTCTTTCCA
TAGGTCTTACTATCCGGCTTATCGGCTGCGGCCTCATGATCCACTCTCGAGGTGCAAACGCTTCAGATGCCGAAA
TTGTATGGTCGCAGCTCCTTCAAGGTATCGGTGGAGGAATCGCCGCTGTCGCATCCCAAGTTGGTGCACAAGCAT
CAGTGACTCATTCCGACGTTGCGATGGCAACTGCTGTTGTTTTGCTTATCACCGAGATTGGTGGTAGTATCGGAA
GCTCCATCGGTGAAAAACTTAATCTATTCCTTTTGGCGAAGTATGCATTTCTAAATACGTTGATTTTAGCTGGTG
CGCTGTGGATGAACATAATGCCTGCGAGAATGGCGAAACATCTTCCGTTCCTTTCACAGAATGAACAAGCTGAGC
TCTTTGGTTCAATTGTTAGTGTGACTCAATATCCTCGTGGCAATCCAATACGAGAAGGTGTCATTCAAGGTCCGT
CTATATTCTAAAATGTTGCGACGTGTTTCTGATTTTATATAGCCTATGATGATGTCATGCGAACGATGACTATTA
CTGCCACCGTCATTGCAGTCATCCCTCTCCTACTTTCATTGTTCATGACGAATTACTACCTTGGCGATTCTCAGA
ATGCGGTTGAACAAAATGATCTCCGGGATATGGATTCCCGTGAAGGAGATAAAGATAATTATCCCATTGATTTGG
ATACAACTGTAGCCAAGAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail