Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|119020
Gene name
Locationscaffold_9:1409279..1410379
Strand+
Gene length (bp)1100
Transcript length (bp)552
Coding sequence length (bp)552
Protein length (aa) 184

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain 2.3E-10 80 156

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12184|ADRX_YEAST Adrenodoxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAH1 PE=1 SV=1 50 173 1.0E-43
sp|Q9M0V0|MFDX1_ARATH Adrenodoxin-like protein 1, mitochondrial OS=Arabidopsis thaliana GN=MFDX1 PE=1 SV=1 39 183 9.0E-38
sp|Q08C57|ADXL_DANRE Adrenodoxin-like protein, mitochondrial OS=Danio rerio GN=fdx1l PE=2 SV=1 67 183 9.0E-38
sp|Q9AKM6|FER2_RICMO 2Fe-2S ferredoxin OS=Rickettsia montanensis GN=fdxB PE=3 SV=1 67 173 2.0E-36
sp|Q5FWQ0|ADXL_XENLA Adrenodoxin-like protein, mitochondrial OS=Xenopus laevis GN=fdx1l PE=2 SV=1 67 183 4.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12184|ADRX_YEAST Adrenodoxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAH1 PE=1 SV=1 50 173 1.0E-43
sp|Q9M0V0|MFDX1_ARATH Adrenodoxin-like protein 1, mitochondrial OS=Arabidopsis thaliana GN=MFDX1 PE=1 SV=1 39 183 9.0E-38
sp|Q08C57|ADXL_DANRE Adrenodoxin-like protein, mitochondrial OS=Danio rerio GN=fdx1l PE=2 SV=1 67 183 9.0E-38
sp|Q9AKM6|FER2_RICMO 2Fe-2S ferredoxin OS=Rickettsia montanensis GN=fdxB PE=3 SV=1 67 173 2.0E-36
sp|Q5FWQ0|ADXL_XENLA Adrenodoxin-like protein, mitochondrial OS=Xenopus laevis GN=fdx1l PE=2 SV=1 67 183 4.0E-36
sp|P37193|ADXH_DROME Adrenodoxin-like protein, mitochondrial OS=Drosophila melanogaster GN=Fdxh PE=2 SV=3 36 183 4.0E-36
sp|Q8S904|MFDX2_ARATH Adrenodoxin-like protein 2, mitochondrial OS=Arabidopsis thaliana GN=MFDX2 PE=2 SV=1 67 183 5.0E-36
sp|Q9AKC4|FER2_RICTY 2Fe-2S ferredoxin OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fdxB PE=3 SV=1 80 179 7.0E-36
sp|Q9AKH1|FER2_RICRI 2Fe-2S ferredoxin OS=Rickettsia rickettsii GN=fdxB PE=3 SV=1 67 173 9.0E-36
sp|Q4UKL2|FER2_RICFE 2Fe-2S ferredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fdxB PE=3 SV=1 67 173 1.0E-35
sp|Q6P4F2|ADXL_HUMAN Adrenodoxin-like protein, mitochondrial OS=Homo sapiens GN=FDX1L PE=1 SV=1 56 183 2.0E-35
sp|Q9ZDW6|FER2_RICPR 2Fe-2S ferredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=fdxB PE=3 SV=1 80 173 4.0E-35
sp|Q92J08|FER2_RICCN 2Fe-2S ferredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fdxB PE=3 SV=1 67 173 5.0E-35
sp|Q05B51|ADXL_BOVIN Adrenodoxin-like protein, mitochondrial OS=Bos taurus GN=FDX1L PE=2 SV=1 56 183 7.0E-35
sp|Q9CPW2|ADXL_MOUSE Adrenodoxin-like protein, mitochondrial OS=Mus musculus GN=Fdx1l PE=1 SV=1 36 183 1.0E-33
sp|Q10361|ETP1_SCHPO Electron transfer protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=etp1 PE=1 SV=2 43 179 4.0E-33
sp|Q8SV19|ADRX_ENCCU Adrenodoxin homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0600 PE=3 SV=1 67 183 4.0E-32
sp|Q1RJ69|FER2_RICBR 2Fe-2S ferredoxin OS=Rickettsia bellii (strain RML369-C) GN=fdxB PE=3 SV=1 67 173 7.0E-31
sp|P46656|ADX_MOUSE Adrenodoxin, mitochondrial OS=Mus musculus GN=Fdx1 PE=1 SV=1 67 173 3.0E-29
sp|P24483|ADX_RAT Adrenodoxin, mitochondrial OS=Rattus norvegicus GN=Fdx1 PE=2 SV=1 67 173 5.0E-29
sp|P00258|ADX_PIG Adrenodoxin, mitochondrial OS=Sus scrofa GN=FDX1 PE=1 SV=2 41 170 3.0E-28
sp|P10109|ADX_HUMAN Adrenodoxin, mitochondrial OS=Homo sapiens GN=FDX1 PE=1 SV=1 67 167 6.0E-28
sp|P00257|ADX_BOVIN Adrenodoxin, mitochondrial OS=Bos taurus GN=FDX1 PE=1 SV=2 67 170 8.0E-28
sp|P29330|ADX_SHEEP Adrenodoxin OS=Ovis aries GN=FDX1 PE=1 SV=2 67 170 1.0E-27
sp|P13216|ADX_CHICK Adrenodoxin, mitochondrial (Fragment) OS=Gallus gallus GN=FDX1 PE=1 SV=1 67 170 5.0E-27
sp|P0A9R6|FER_SHIFL 2Fe-2S ferredoxin OS=Shigella flexneri GN=fdx PE=3 SV=2 81 172 6.0E-17
sp|P0A9R4|FER_ECOLI 2Fe-2S ferredoxin OS=Escherichia coli (strain K12) GN=fdx PE=1 SV=2 81 172 6.0E-17
sp|P0A9R5|FER_ECO57 2Fe-2S ferredoxin OS=Escherichia coli O157:H7 GN=fdx PE=3 SV=2 81 172 6.0E-17
sp|P44428|FER_HAEIN 2Fe-2S ferredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fdx PE=3 SV=2 81 158 7.0E-14
sp|O51882|FER_BUCAP 2Fe-2S ferredoxin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fdx PE=3 SV=1 68 152 8.0E-13
sp|Q51383|FER_PSEAE 2Fe-2S ferredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fdx PE=3 SV=2 83 177 1.0E-12
sp|P57661|FER_BUCAI 2Fe-2S ferredoxin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fdx PE=3 SV=1 68 157 3.0E-12
sp|P80306|FER6_RHOCA Ferredoxin-6 OS=Rhodobacter capsulatus GN=fdxE PE=1 SV=2 68 167 1.0E-11
sp|Q89A15|FER_BUCBP 2Fe-2S ferredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fdx PE=3 SV=1 86 156 1.0E-09
sp|D5IGG4|CARAC_SPHSX Ferredoxin CarAc OS=Sphingomonas sp. GN=carAc PE=1 SV=1 67 169 3.0E-09
sp|P37098|FER2_CAUCR 2Fe-2S ferredoxin OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=fdxB PE=3 SV=1 98 169 5.0E-08
sp|P00259|PUTX_PSEPU Putidaredoxin OS=Pseudomonas putida GN=camB PE=1 SV=3 100 167 6.0E-08
sp|P43493|THCC_RHOER Rhodocoxin OS=Rhodococcus erythropolis GN=thcC PE=1 SV=2 82 167 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0051540 metal cluster binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 36.07 17.58 54.56
Initials Initials knots 24.56 11.62 37.50
Pileal_Stipeal_center Stage I stipe center 60.70 31.97 89.42
Pileal_Stipeal_shell Stage I stipe shell 63.22 33.72 92.71
DIF_stipe_center Stage II stipe center 65.60 35.53 95.66
DIF_stipe_shell Stage II stipe shell 52.87 27.78 77.97
DIF_stipe_skin Stage II stipe skin 50.91 26.02 75.80
DIF_cap_skin Stage II cap skin 59.23 31.27 87.20
DIF_cap_tissue Stage II cap tissue 72.69 39.96 105.43
DIF_gill_tissue Stage II gill tissue 84.55 46.68 122.43
YFB_stipe_center Young fruiting body stipe center 61.32 32.81 89.83
YFB_stipe_shell Young fruiting body stipe shell 46.68 24.00 69.35
YFB_stipe_skin Young fruiting body stipe skin 52.83 27.88 77.78
YFB_cap_skin Young fruiting body cap skin 46.75 24.32 69.19
YFB_cap_tissue Young fruiting body cap tissue 70.05 38.25 101.84
YFB_gill_tissue Young fruiting body gill tissue 51.95 26.94 76.97
YFB_veil Young fruiting body veil 66.71 36.40 97.02

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.005302 yes
Casing YFB_stipe_center 0.112416 no
Casing YFB_stipe_shell 0.565926 no
Casing YFB_stipe_skin 0.311077 no
Casing YFB_cap_skin 0.560412 no
Casing YFB_cap_tissue 0.038278 yes
Casing YFB_gill_tissue 0.336047 no
Casing YFB_veil 0.054982 no
Casing Initials 0.341311 no
Casing Pileal_Stipeal_center 0.128227 no
Casing Pileal_Stipeal_shell 0.087586 no
Casing DIF_stipe_center 0.062807 no
Casing DIF_stipe_shell 0.316518 no
Casing DIF_stipe_skin 0.394266 no
Casing DIF_cap_skin 0.153274 no
Casing DIF_cap_tissue 0.023933 yes
DIF_gill_tissue YFB_stipe_center 0.382133 no
DIF_gill_tissue YFB_stipe_shell 0.065649 no
DIF_gill_tissue YFB_stipe_skin 0.146853 no
DIF_gill_tissue YFB_cap_skin 0.059318 no
DIF_gill_tissue YFB_cap_tissue 0.680762 no
DIF_gill_tissue YFB_gill_tissue 0.129247 no
DIF_gill_tissue YFB_veil 0.568043 no
YFB_stipe_center YFB_stipe_shell 0.515418 no
YFB_stipe_center YFB_stipe_skin 0.769267 no
YFB_stipe_center YFB_cap_skin 0.516246 no
YFB_stipe_center YFB_cap_tissue 0.794299 no
YFB_stipe_center YFB_gill_tissue 0.731521 no
YFB_stipe_center YFB_veil 0.881694 no
YFB_stipe_shell YFB_stipe_skin 0.822361 no
YFB_stipe_shell YFB_cap_skin 0.997845 no
YFB_stipe_shell YFB_cap_tissue 0.259385 no
YFB_stipe_shell YFB_gill_tissue 0.850238 no
YFB_stipe_shell YFB_veil 0.345735 no
YFB_stipe_skin YFB_cap_skin 0.824133 no
YFB_stipe_skin YFB_cap_tissue 0.483573 no
YFB_stipe_skin YFB_gill_tissue 0.979289 no
YFB_stipe_skin YFB_veil 0.588206 no
YFB_cap_skin YFB_cap_tissue 0.263203 no
YFB_cap_skin YFB_gill_tissue 0.851857 no
YFB_cap_skin YFB_veil 0.348642 no
YFB_cap_tissue YFB_gill_tissue 0.439825 no
YFB_cap_tissue YFB_veil 0.935636 no
YFB_gill_tissue YFB_veil 0.552634 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.002525 yes
Initials YFB_stipe_shell 0.064520 no
Initials YFB_stipe_skin 0.016949 yes
Initials YFB_cap_skin 0.058147 no
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.021583 yes
Initials YFB_veil 0.002084 yes
Initials Pileal_Stipeal_center 0.002951 yes
Initials Pileal_Stipeal_shell 0.002525 yes
Initials DIF_stipe_center 0.001625 yes
Initials DIF_stipe_shell 0.019169 yes
Initials DIF_stipe_skin 0.030610 yes
Initials DIF_cap_skin 0.005302 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.374561 no
Pileal_Stipeal_center YFB_stipe_center 0.987229 no
Pileal_Stipeal_center YFB_stipe_shell 0.546630 no
Pileal_Stipeal_center YFB_stipe_skin 0.795220 no
Pileal_Stipeal_center YFB_cap_skin 0.548040 no
Pileal_Stipeal_center YFB_cap_tissue 0.780845 no
Pileal_Stipeal_center YFB_gill_tissue 0.759503 no
Pileal_Stipeal_center YFB_veil 0.867190 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.948073 no
Pileal_Stipeal_center DIF_stipe_center 0.894349 no
Pileal_Stipeal_center DIF_stipe_shell 0.796647 no
Pileal_Stipeal_center DIF_stipe_skin 0.727013 no
Pileal_Stipeal_center DIF_cap_skin 0.969566 no
Pileal_Stipeal_center DIF_cap_tissue 0.695266 no
Pileal_Stipeal_shell DIF_gill_tissue 0.440321 no
Pileal_Stipeal_shell YFB_stipe_center 0.960358 no
Pileal_Stipeal_shell YFB_stipe_shell 0.448116 no
Pileal_Stipeal_shell YFB_stipe_skin 0.706858 no
Pileal_Stipeal_shell YFB_cap_skin 0.446054 no
Pileal_Stipeal_shell YFB_cap_tissue 0.850733 no
Pileal_Stipeal_shell YFB_gill_tissue 0.665242 no
Pileal_Stipeal_shell YFB_veil 0.929482 no
Pileal_Stipeal_shell DIF_stipe_center 0.953015 no
Pileal_Stipeal_shell DIF_stipe_shell 0.711125 no
Pileal_Stipeal_shell DIF_stipe_skin 0.633073 no
Pileal_Stipeal_shell DIF_cap_skin 0.913543 no
Pileal_Stipeal_shell DIF_cap_tissue 0.773017 no
DIF_stipe_center DIF_gill_tissue 0.526709 no
DIF_stipe_center YFB_stipe_center 0.906475 no
DIF_stipe_center YFB_stipe_shell 0.382454 no
DIF_stipe_center YFB_stipe_skin 0.625885 no
DIF_stipe_center YFB_cap_skin 0.381485 no
DIF_stipe_center YFB_cap_tissue 0.911802 no
DIF_stipe_center YFB_gill_tissue 0.582971 no
DIF_stipe_center YFB_veil 0.978566 no
DIF_stipe_center DIF_stipe_shell 0.633639 no
DIF_stipe_center DIF_stipe_skin 0.555552 no
DIF_stipe_center DIF_cap_skin 0.854327 no
DIF_stipe_center DIF_cap_tissue 0.848035 no
DIF_stipe_shell DIF_gill_tissue 0.142929 no
DIF_stipe_shell YFB_stipe_center 0.766740 no
DIF_stipe_shell YFB_stipe_shell 0.821000 no
DIF_stipe_shell YFB_stipe_skin 0.999191 no
DIF_stipe_shell YFB_cap_skin 0.823374 no
DIF_stipe_shell YFB_cap_tissue 0.479522 no
DIF_stipe_shell YFB_gill_tissue 0.978747 no
DIF_stipe_shell YFB_veil 0.586494 no
DIF_stipe_shell DIF_stipe_skin 0.954182 no
DIF_stipe_shell DIF_cap_skin 0.835415 no
DIF_stipe_shell DIF_cap_tissue 0.384577 no
DIF_stipe_skin DIF_gill_tissue 0.124412 no
DIF_stipe_skin YFB_stipe_center 0.694804 no
DIF_stipe_skin YFB_stipe_shell 0.887831 no
DIF_stipe_skin YFB_stipe_skin 0.955787 no
DIF_stipe_skin YFB_cap_skin 0.890171 no
DIF_stipe_skin YFB_cap_tissue 0.412952 no
DIF_stipe_skin YFB_gill_tissue 0.976502 no
DIF_stipe_skin YFB_veil 0.518034 no
DIF_stipe_skin DIF_cap_skin 0.772165 no
DIF_stipe_skin DIF_cap_tissue 0.329846 no
DIF_cap_skin DIF_gill_tissue 0.334080 no
DIF_cap_skin YFB_stipe_center 0.955931 no
DIF_cap_skin YFB_stipe_shell 0.601162 no
DIF_cap_skin YFB_stipe_skin 0.839167 no
DIF_cap_skin YFB_cap_skin 0.602939 no
DIF_cap_skin YFB_cap_tissue 0.733959 no
DIF_cap_skin YFB_gill_tissue 0.808077 no
DIF_cap_skin YFB_veil 0.825214 no
DIF_cap_skin DIF_cap_tissue 0.643140 no
DIF_cap_tissue DIF_gill_tissue 0.747052 no
DIF_cap_tissue YFB_stipe_center 0.709651 no
DIF_cap_tissue YFB_stipe_shell 0.204111 no
DIF_cap_tissue YFB_stipe_skin 0.394738 no
DIF_cap_tissue YFB_cap_skin 0.196285 no
DIF_cap_tissue YFB_cap_tissue 0.951299 no
DIF_cap_tissue YFB_gill_tissue 0.351660 no
DIF_cap_tissue YFB_veil 0.875284 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|119020
MTSSELLNHKFFASARLQIDDWTFSAGRKEYMVQRRDSFLSAHSRSLHATSAARHGGIDRPAPGTGIKVHFKDSK
GTLIKTVEGNEGDDLLDVAHEYDIDLEGACEKSLACSTCHVILTPDVYDKLPEPEDDENDMLDMAFGLTETSRLG
CQVKLTKELDGMTAVLPSATRNMFVDGKKPTKH*
Coding >AgabiH97|119020
ATGACCTCTTCCGAGTTGCTGAACCACAAATTTTTCGCATCTGCAAGACTGCAAATCGATGACTGGACTTTTTCG
GCGGGCAGAAAAGAATACATGGTTCAGCGGCGGGACTCGTTTTTATCCGCTCACAGCCGGTCACTACACGCGACT
TCTGCCGCAAGACATGGTGGAATTGACAGGCCAGCTCCAGGCACAGGGATTAAGGTCCATTTTAAAGATTCCAAG
GGAACCTTGATCAAGACGGTGGAAGGTAATGAGGGCGACGACTTGTTAGACGTAGCACACGAGTATGACATTGAT
CTAGAAGGGGCCTGCGAAAAATCTCTTGCTTGTTCGACGTGCCATGTAATCCTTACTCCTGACGTCTATGATAAG
CTTCCAGAGCCTGAAGACGATGAGAATGATATGTTGGATATGGCTTTTGGTCTCACGGAGACTAGTCGACTAGGG
TGTCAAGTGAAGCTGACCAAGGAATTGGATGGTATGACGGCTGTTCTTCCATCGGCAACGAGGAATATGTTCGTT
GATGGTAAAAAACCCACGAAGCATTGA
Transcript >AgabiH97|119020
ATGACCTCTTCCGAGTTGCTGAACCACAAATTTTTCGCATCTGCAAGACTGCAAATCGATGACTGGACTTTTTCG
GCGGGCAGAAAAGAATACATGGTTCAGCGGCGGGACTCGTTTTTATCCGCTCACAGCCGGTCACTACACGCGACT
TCTGCCGCAAGACATGGTGGAATTGACAGGCCAGCTCCAGGCACAGGGATTAAGGTCCATTTTAAAGATTCCAAG
GGAACCTTGATCAAGACGGTGGAAGGTAATGAGGGCGACGACTTGTTAGACGTAGCACACGAGTATGACATTGAT
CTAGAAGGGGCCTGCGAAAAATCTCTTGCTTGTTCGACGTGCCATGTAATCCTTACTCCTGACGTCTATGATAAG
CTTCCAGAGCCTGAAGACGATGAGAATGATATGTTGGATATGGCTTTTGGTCTCACGGAGACTAGTCGACTAGGG
TGTCAAGTGAAGCTGACCAAGGAATTGGATGGTATGACGGCTGTTCTTCCATCGGCAACGAGGAATATGTTCGTT
GATGGTAAAAAACCCACGAAGCATTGA
Gene >AgabiH97|119020
ATGACCTCTTCCGAGTTGCTGAACCACAAATTTTTCGCATCTGCAAGACTGCAAATCGTATGTTCTTTTCGAAAT
TTCAGCGAGAACTGCCCACTAAACCTTAGTTTCACACTTGTATCACTCCAGGATGACTGGACTGTGTTTACGAAC
AAATTGCCTTTTCAGAGCAGTGTCAATTTGTGACAGAGGACTAGTTTTCGGCGGGCAGAAAAGAATACATGGTTC
AGCGGTGAATCTGTTGCGAAACACACCATATCTACCTCCGCGGTCGGAAAAAAGCCGGTTTTCCCCCAGGCGGGA
CTCGTTTTTATCCGCTCACAGCCGGTCACTACACGCGACTTCTGGTGCGTTCCATCCTAGTTTTGCATCAGCTAG
CACCCTAACAATGAATTTCCTTTCGTGTTTATAGCCGCAAGACATGGTGGAATTGACAGGCCAGCTCCAGGCACA
GGGTGAGTATGATCTGGATTCGCGTTCTCCATCACGGCCTCAACCATGTCAGGATTAAGGTCCATTTTAAAGATT
CCAAGGGAACCTTGATCAAGACGGTGGAAGGTAATGAGGGCGACGACTTGTTAGACGTAGCACACGAGTATGACA
TTGATCTAGAAGGTACGACGTGTTTAATTCCTCCCCTTTCCCCAACAAATTCTTACGCTTGGTCCGCCTTCTACT
TTGTATATTTCCACTCCTCACGGACGACCACCAATCAATCATCATTGTGTTACCCCCTTCCCGCAAACCCCTCCG
TTCCCTTGATCGGGATTATGTTGCTTCTCGGATCCTCAGGGGCCTGCGAAAAATCTCTTGCTTGTTCGACGTGCC
ATGTAATCCTTACTCCTGACGTCTATGATAAGCTTCCAGAGCCTGAAGACGATGAGAATGATATGTTGGATATGG
CTTTTGGTCTCACGGAGACTAGTCGACTAGGGTGTCAAGTGAAGCTGACCAAGGAATTGGATGGTATGACGGCTG
TTCTTCCATCGGCAACGAGGAATATGTTCGTTGATGGTGAGTCGCCGTCTTCGGATTCTACGAATCCTTCTGTAC
TCACGCTTTTTTGTTCTATTTCCGCAGGTAAAAAACCCACGAAGCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail