Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|119020
Gene name
Locationscaffold_9:1409279..1410379
Strand+
Gene length (bp)1100
Transcript length (bp)552
Coding sequence length (bp)552
Protein length (aa) 184

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain 2.3E-10 80 156

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12184|ADRX_YEAST Adrenodoxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAH1 PE=1 SV=1 50 173 1.0E-43
sp|Q9M0V0|MFDX1_ARATH Adrenodoxin-like protein 1, mitochondrial OS=Arabidopsis thaliana GN=MFDX1 PE=1 SV=1 39 183 9.0E-38
sp|Q08C57|ADXL_DANRE Adrenodoxin-like protein, mitochondrial OS=Danio rerio GN=fdx1l PE=2 SV=1 67 183 9.0E-38
sp|Q9AKM6|FER2_RICMO 2Fe-2S ferredoxin OS=Rickettsia montanensis GN=fdxB PE=3 SV=1 67 173 2.0E-36
sp|Q5FWQ0|ADXL_XENLA Adrenodoxin-like protein, mitochondrial OS=Xenopus laevis GN=fdx1l PE=2 SV=1 67 183 4.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12184|ADRX_YEAST Adrenodoxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAH1 PE=1 SV=1 50 173 1.0E-43
sp|Q9M0V0|MFDX1_ARATH Adrenodoxin-like protein 1, mitochondrial OS=Arabidopsis thaliana GN=MFDX1 PE=1 SV=1 39 183 9.0E-38
sp|Q08C57|ADXL_DANRE Adrenodoxin-like protein, mitochondrial OS=Danio rerio GN=fdx1l PE=2 SV=1 67 183 9.0E-38
sp|Q9AKM6|FER2_RICMO 2Fe-2S ferredoxin OS=Rickettsia montanensis GN=fdxB PE=3 SV=1 67 173 2.0E-36
sp|Q5FWQ0|ADXL_XENLA Adrenodoxin-like protein, mitochondrial OS=Xenopus laevis GN=fdx1l PE=2 SV=1 67 183 4.0E-36
sp|P37193|ADXH_DROME Adrenodoxin-like protein, mitochondrial OS=Drosophila melanogaster GN=Fdxh PE=2 SV=3 36 183 4.0E-36
sp|Q8S904|MFDX2_ARATH Adrenodoxin-like protein 2, mitochondrial OS=Arabidopsis thaliana GN=MFDX2 PE=2 SV=1 67 183 5.0E-36
sp|Q9AKC4|FER2_RICTY 2Fe-2S ferredoxin OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fdxB PE=3 SV=1 80 179 7.0E-36
sp|Q9AKH1|FER2_RICRI 2Fe-2S ferredoxin OS=Rickettsia rickettsii GN=fdxB PE=3 SV=1 67 173 9.0E-36
sp|Q4UKL2|FER2_RICFE 2Fe-2S ferredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fdxB PE=3 SV=1 67 173 1.0E-35
sp|Q6P4F2|ADXL_HUMAN Adrenodoxin-like protein, mitochondrial OS=Homo sapiens GN=FDX1L PE=1 SV=1 56 183 2.0E-35
sp|Q9ZDW6|FER2_RICPR 2Fe-2S ferredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=fdxB PE=3 SV=1 80 173 4.0E-35
sp|Q92J08|FER2_RICCN 2Fe-2S ferredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fdxB PE=3 SV=1 67 173 5.0E-35
sp|Q05B51|ADXL_BOVIN Adrenodoxin-like protein, mitochondrial OS=Bos taurus GN=FDX1L PE=2 SV=1 56 183 7.0E-35
sp|Q9CPW2|ADXL_MOUSE Adrenodoxin-like protein, mitochondrial OS=Mus musculus GN=Fdx1l PE=1 SV=1 36 183 1.0E-33
sp|Q10361|ETP1_SCHPO Electron transfer protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=etp1 PE=1 SV=2 43 179 4.0E-33
sp|Q8SV19|ADRX_ENCCU Adrenodoxin homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0600 PE=3 SV=1 67 183 4.0E-32
sp|Q1RJ69|FER2_RICBR 2Fe-2S ferredoxin OS=Rickettsia bellii (strain RML369-C) GN=fdxB PE=3 SV=1 67 173 7.0E-31
sp|P46656|ADX_MOUSE Adrenodoxin, mitochondrial OS=Mus musculus GN=Fdx1 PE=1 SV=1 67 173 3.0E-29
sp|P24483|ADX_RAT Adrenodoxin, mitochondrial OS=Rattus norvegicus GN=Fdx1 PE=2 SV=1 67 173 5.0E-29
sp|P00258|ADX_PIG Adrenodoxin, mitochondrial OS=Sus scrofa GN=FDX1 PE=1 SV=2 41 170 3.0E-28
sp|P10109|ADX_HUMAN Adrenodoxin, mitochondrial OS=Homo sapiens GN=FDX1 PE=1 SV=1 67 167 6.0E-28
sp|P00257|ADX_BOVIN Adrenodoxin, mitochondrial OS=Bos taurus GN=FDX1 PE=1 SV=2 67 170 8.0E-28
sp|P29330|ADX_SHEEP Adrenodoxin OS=Ovis aries GN=FDX1 PE=1 SV=2 67 170 1.0E-27
sp|P13216|ADX_CHICK Adrenodoxin, mitochondrial (Fragment) OS=Gallus gallus GN=FDX1 PE=1 SV=1 67 170 5.0E-27
sp|P0A9R6|FER_SHIFL 2Fe-2S ferredoxin OS=Shigella flexneri GN=fdx PE=3 SV=2 81 172 6.0E-17
sp|P0A9R4|FER_ECOLI 2Fe-2S ferredoxin OS=Escherichia coli (strain K12) GN=fdx PE=1 SV=2 81 172 6.0E-17
sp|P0A9R5|FER_ECO57 2Fe-2S ferredoxin OS=Escherichia coli O157:H7 GN=fdx PE=3 SV=2 81 172 6.0E-17
sp|P44428|FER_HAEIN 2Fe-2S ferredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fdx PE=3 SV=2 81 158 7.0E-14
sp|O51882|FER_BUCAP 2Fe-2S ferredoxin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fdx PE=3 SV=1 68 152 8.0E-13
sp|Q51383|FER_PSEAE 2Fe-2S ferredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fdx PE=3 SV=2 83 177 1.0E-12
sp|P57661|FER_BUCAI 2Fe-2S ferredoxin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fdx PE=3 SV=1 68 157 3.0E-12
sp|P80306|FER6_RHOCA Ferredoxin-6 OS=Rhodobacter capsulatus GN=fdxE PE=1 SV=2 68 167 1.0E-11
sp|Q89A15|FER_BUCBP 2Fe-2S ferredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fdx PE=3 SV=1 86 156 1.0E-09
sp|D5IGG4|CARAC_SPHSX Ferredoxin CarAc OS=Sphingomonas sp. GN=carAc PE=1 SV=1 67 169 3.0E-09
sp|P37098|FER2_CAUCR 2Fe-2S ferredoxin OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=fdxB PE=3 SV=1 98 169 5.0E-08
sp|P00259|PUTX_PSEPU Putidaredoxin OS=Pseudomonas putida GN=camB PE=1 SV=3 100 167 6.0E-08
sp|P43493|THCC_RHOER Rhodocoxin OS=Rhodococcus erythropolis GN=thcC PE=1 SV=2 82 167 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0051540 metal cluster binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|119020
MTSSELLNHKFFASARLQIDDWTFSAGRKEYMVQRRDSFLSAHSRSLHATSAARHGGIDRPAPGTGIKVHFKDSK
GTLIKTVEGNEGDDLLDVAHEYDIDLEGACEKSLACSTCHVILTPDVYDKLPEPEDDENDMLDMAFGLTETSRLG
CQVKLTKELDGMTAVLPSATRNMFVDGKKPTKH*
Coding >AgabiH97|119020
ATGACCTCTTCCGAGTTGCTGAACCACAAATTTTTCGCATCTGCAAGACTGCAAATCGATGACTGGACTTTTTCG
GCGGGCAGAAAAGAATACATGGTTCAGCGGCGGGACTCGTTTTTATCCGCTCACAGCCGGTCACTACACGCGACT
TCTGCCGCAAGACATGGTGGAATTGACAGGCCAGCTCCAGGCACAGGGATTAAGGTCCATTTTAAAGATTCCAAG
GGAACCTTGATCAAGACGGTGGAAGGTAATGAGGGCGACGACTTGTTAGACGTAGCACACGAGTATGACATTGAT
CTAGAAGGGGCCTGCGAAAAATCTCTTGCTTGTTCGACGTGCCATGTAATCCTTACTCCTGACGTCTATGATAAG
CTTCCAGAGCCTGAAGACGATGAGAATGATATGTTGGATATGGCTTTTGGTCTCACGGAGACTAGTCGACTAGGG
TGTCAAGTGAAGCTGACCAAGGAATTGGATGGTATGACGGCTGTTCTTCCATCGGCAACGAGGAATATGTTCGTT
GATGGTAAAAAACCCACGAAGCATTGA
Transcript >AgabiH97|119020
ATGACCTCTTCCGAGTTGCTGAACCACAAATTTTTCGCATCTGCAAGACTGCAAATCGATGACTGGACTTTTTCG
GCGGGCAGAAAAGAATACATGGTTCAGCGGCGGGACTCGTTTTTATCCGCTCACAGCCGGTCACTACACGCGACT
TCTGCCGCAAGACATGGTGGAATTGACAGGCCAGCTCCAGGCACAGGGATTAAGGTCCATTTTAAAGATTCCAAG
GGAACCTTGATCAAGACGGTGGAAGGTAATGAGGGCGACGACTTGTTAGACGTAGCACACGAGTATGACATTGAT
CTAGAAGGGGCCTGCGAAAAATCTCTTGCTTGTTCGACGTGCCATGTAATCCTTACTCCTGACGTCTATGATAAG
CTTCCAGAGCCTGAAGACGATGAGAATGATATGTTGGATATGGCTTTTGGTCTCACGGAGACTAGTCGACTAGGG
TGTCAAGTGAAGCTGACCAAGGAATTGGATGGTATGACGGCTGTTCTTCCATCGGCAACGAGGAATATGTTCGTT
GATGGTAAAAAACCCACGAAGCATTGA
Gene >AgabiH97|119020
ATGACCTCTTCCGAGTTGCTGAACCACAAATTTTTCGCATCTGCAAGACTGCAAATCGTATGTTCTTTTCGAAAT
TTCAGCGAGAACTGCCCACTAAACCTTAGTTTCACACTTGTATCACTCCAGGATGACTGGACTGTGTTTACGAAC
AAATTGCCTTTTCAGAGCAGTGTCAATTTGTGACAGAGGACTAGTTTTCGGCGGGCAGAAAAGAATACATGGTTC
AGCGGTGAATCTGTTGCGAAACACACCATATCTACCTCCGCGGTCGGAAAAAAGCCGGTTTTCCCCCAGGCGGGA
CTCGTTTTTATCCGCTCACAGCCGGTCACTACACGCGACTTCTGGTGCGTTCCATCCTAGTTTTGCATCAGCTAG
CACCCTAACAATGAATTTCCTTTCGTGTTTATAGCCGCAAGACATGGTGGAATTGACAGGCCAGCTCCAGGCACA
GGGTGAGTATGATCTGGATTCGCGTTCTCCATCACGGCCTCAACCATGTCAGGATTAAGGTCCATTTTAAAGATT
CCAAGGGAACCTTGATCAAGACGGTGGAAGGTAATGAGGGCGACGACTTGTTAGACGTAGCACACGAGTATGACA
TTGATCTAGAAGGTACGACGTGTTTAATTCCTCCCCTTTCCCCAACAAATTCTTACGCTTGGTCCGCCTTCTACT
TTGTATATTTCCACTCCTCACGGACGACCACCAATCAATCATCATTGTGTTACCCCCTTCCCGCAAACCCCTCCG
TTCCCTTGATCGGGATTATGTTGCTTCTCGGATCCTCAGGGGCCTGCGAAAAATCTCTTGCTTGTTCGACGTGCC
ATGTAATCCTTACTCCTGACGTCTATGATAAGCTTCCAGAGCCTGAAGACGATGAGAATGATATGTTGGATATGG
CTTTTGGTCTCACGGAGACTAGTCGACTAGGGTGTCAAGTGAAGCTGACCAAGGAATTGGATGGTATGACGGCTG
TTCTTCCATCGGCAACGAGGAATATGTTCGTTGATGGTGAGTCGCCGTCTTCGGATTCTACGAATCCTTCTGTAC
TCACGCTTTTTTGTTCTATTTCCGCAGGTAAAAAACCCACGAAGCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail