Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|118830
Gene name
Locationscaffold_9:1372821..1374888
Strand-
Gene length (bp)2067
Transcript length (bp)1263
Coding sequence length (bp)1263
Protein length (aa) 421

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.6E-16 20 313

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 2 406 2.0E-36
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 13 413 9.0E-28
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 15 418 4.0E-17
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 15 406 1.0E-15
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 15 420 3.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 2 406 2.0E-36
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 13 413 9.0E-28
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 15 418 4.0E-17
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 15 406 1.0E-15
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 15 420 3.0E-15
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 15 415 5.0E-15
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 15 392 6.0E-14
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 15 418 7.0E-14
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 2 376 1.0E-13
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 15 418 1.0E-13
sp|G5E8K6|MOT6_MOUSE Monocarboxylate transporter 6 OS=Mus musculus GN=Slc16a5 PE=3 SV=1 4 286 7.0E-12
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 15 375 1.0E-11
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 15 375 1.0E-11
sp|O35308|MOT3_MOUSE Monocarboxylate transporter 3 OS=Mus musculus GN=Slc16a8 PE=2 SV=2 15 375 3.0E-11
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 15 375 4.0E-11
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 15 413 8.0E-11
sp|O70461|MOT3_RAT Monocarboxylate transporter 3 OS=Rattus norvegicus GN=Slc16a8 PE=2 SV=1 15 375 5.0E-10
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 6 407 4.0E-09
sp|Q90632|MOT3_CHICK Monocarboxylate transporter 3 OS=Gallus gallus GN=SLC16A3 PE=2 SV=2 15 375 1.0E-08
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 6 407 2.0E-08
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 120 373 2.0E-08
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 120 373 3.0E-08
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 50 411 6.0E-08
sp|O15375|MOT6_HUMAN Monocarboxylate transporter 6 OS=Homo sapiens GN=SLC16A5 PE=2 SV=1 4 390 1.0E-07
sp|B1AT66|MOT7_MOUSE Monocarboxylate transporter 7 OS=Mus musculus GN=Slc16a6 PE=1 SV=1 15 152 1.0E-07
sp|P53988|MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus GN=SLC16A7 PE=1 SV=1 53 387 2.0E-07
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 120 373 2.0E-07
sp|O95907|MOT3_HUMAN Monocarboxylate transporter 3 OS=Homo sapiens GN=SLC16A8 PE=2 SV=1 15 155 3.0E-07
sp|O15403|MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens GN=SLC16A6 PE=1 SV=2 15 152 4.0E-07
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 15 407 7.0E-07
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 15 375 7.0E-07
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 2 376 1.0E-06
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 6 418 1.0E-06
sp|Q7RTX9|MOT14_HUMAN Monocarboxylate transporter 14 OS=Homo sapiens GN=SLC16A14 PE=2 SV=1 15 221 2.0E-06
sp|Q8K1C7|MOT14_MOUSE Monocarboxylate transporter 14 OS=Mus musculus GN=Slc16a14 PE=2 SV=1 15 183 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 55 74 19
3 81 103 22
4 113 135 22
5 142 164 22
6 179 198 19
7 225 247 22
8 252 274 22
9 287 309 22
10 313 335 22
11 348 367 19
12 382 404 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|118830
MQKEAAEEFEPKKVWLIALATWLVQFCTYGYVSAFGVYQDYYTRDYLSASTPSDISWIGSVQLFLQYALGIVVGR
IYDLGWFHHLIGVGTVLQTVSLFMLSLTRRQRYPEIFLAQAIGMGLGQAMLFLPSITVVSHHFRRRRVVATGVAV
SGASVGGVIWPILLNQSSQALGFPNAIRITAALIGAFLLVANLLYFIACSRPTSISSSTSFQSSRPDFRAIFTDV
AYLVSIAAAFCINLGLFFPFFYLQSYALSVGIKSSLAFYLLAILNGGSAFGRIIPNILAGKFGVYNTLLPSLYIS
SALVFAIFGIKNFAGLTIFAILYGFWSGAYVSLIPSLLCQLSPHPKELGVRMGIAFSLVAISLLAGTPIEGMLLK
RQSGGGFVWSASIIFCGVLIGCGSICMTISRFLYIRSRRIHKQCV*
Coding >AgabiH97|118830
ATGCAAAAGGAAGCAGCCGAAGAATTTGAACCCAAGAAAGTCTGGCTCATCGCCCTTGCAACATGGCTTGTGCAA
TTCTGTACTTATGGCTATGTGTCGGCGTTTGGCGTCTATCAAGACTATTACACCCGAGATTATTTGAGTGCAAGT
ACGCCGTCCGATATCAGTTGGATAGGCAGCGTACAACTCTTCTTGCAGTATGCCCTCGGGATTGTTGTCGGCAGG
ATATATGATCTCGGTTGGTTCCACCACTTGATTGGCGTGGGCACTGTCCTTCAAACTGTGTCGTTGTTTATGCTT
TCACTGACTCGCCGCCAACGCTATCCGGAGATTTTTCTCGCGCAAGCTATTGGCATGGGCCTAGGACAAGCGATG
CTATTTTTGCCTTCAATCACAGTGGTGTCGCACCATTTTAGAAGACGTAGGGTGGTGGCGACAGGTGTCGCGGTA
TCGGGTGCTTCCGTAGGGGGTGTTATATGGCCGATTTTACTAAATCAGAGCAGCCAAGCATTGGGTTTTCCCAAT
GCCATTCGTATAACCGCGGCTCTCATCGGCGCTTTCCTCCTCGTCGCGAATCTCCTTTACTTCATTGCGTGTTCA
AGACCGACTTCTATCTCTTCTTCAACGTCCTTTCAGAGTAGCAGACCAGACTTCCGAGCCATATTCACGGATGTT
GCCTATTTGGTGTCTATCGCAGCAGCGTTTTGTATCAATCTGGGACTATTCTTCCCATTCTTTTATCTACAATCG
TATGCTCTTTCCGTGGGAATCAAATCTTCGCTTGCCTTTTATCTGTTGGCTATTTTGAATGGAGGCAGCGCGTTC
GGACGTATCATTCCTAATATTCTAGCTGGAAAATTTGGGGTGTACAATACGTTACTTCCGTCCCTCTACATCTCA
TCAGCGCTGGTCTTCGCTATCTTCGGCATTAAAAACTTCGCTGGCTTGACAATCTTCGCCATTCTATATGGATTT
TGGTCTGGAGCATATGTGTCCCTCATCCCTTCGTTACTCTGTCAACTTAGTCCTCACCCAAAAGAACTGGGGGTT
CGCATGGGCATAGCATTCTCACTTGTGGCGATTTCCTTATTAGCGGGAACTCCAATAGAAGGGATGTTGCTAAAA
CGACAAAGTGGCGGCGGTTTCGTGTGGAGTGCTTCAATCATCTTTTGTGGCGTTTTGATAGGTTGCGGATCGATT
TGCATGACTATTTCAAGATTTCTTTACATTCGGAGTCGCCGAATCCATAAACAATGCGTATGA
Transcript >AgabiH97|118830
ATGCAAAAGGAAGCAGCCGAAGAATTTGAACCCAAGAAAGTCTGGCTCATCGCCCTTGCAACATGGCTTGTGCAA
TTCTGTACTTATGGCTATGTGTCGGCGTTTGGCGTCTATCAAGACTATTACACCCGAGATTATTTGAGTGCAAGT
ACGCCGTCCGATATCAGTTGGATAGGCAGCGTACAACTCTTCTTGCAGTATGCCCTCGGGATTGTTGTCGGCAGG
ATATATGATCTCGGTTGGTTCCACCACTTGATTGGCGTGGGCACTGTCCTTCAAACTGTGTCGTTGTTTATGCTT
TCACTGACTCGCCGCCAACGCTATCCGGAGATTTTTCTCGCGCAAGCTATTGGCATGGGCCTAGGACAAGCGATG
CTATTTTTGCCTTCAATCACAGTGGTGTCGCACCATTTTAGAAGACGTAGGGTGGTGGCGACAGGTGTCGCGGTA
TCGGGTGCTTCCGTAGGGGGTGTTATATGGCCGATTTTACTAAATCAGAGCAGCCAAGCATTGGGTTTTCCCAAT
GCCATTCGTATAACCGCGGCTCTCATCGGCGCTTTCCTCCTCGTCGCGAATCTCCTTTACTTCATTGCGTGTTCA
AGACCGACTTCTATCTCTTCTTCAACGTCCTTTCAGAGTAGCAGACCAGACTTCCGAGCCATATTCACGGATGTT
GCCTATTTGGTGTCTATCGCAGCAGCGTTTTGTATCAATCTGGGACTATTCTTCCCATTCTTTTATCTACAATCG
TATGCTCTTTCCGTGGGAATCAAATCTTCGCTTGCCTTTTATCTGTTGGCTATTTTGAATGGAGGCAGCGCGTTC
GGACGTATCATTCCTAATATTCTAGCTGGAAAATTTGGGGTGTACAATACGTTACTTCCGTCCCTCTACATCTCA
TCAGCGCTGGTCTTCGCTATCTTCGGCATTAAAAACTTCGCTGGCTTGACAATCTTCGCCATTCTATATGGATTT
TGGTCTGGAGCATATGTGTCCCTCATCCCTTCGTTACTCTGTCAACTTAGTCCTCACCCAAAAGAACTGGGGGTT
CGCATGGGCATAGCATTCTCACTTGTGGCGATTTCCTTATTAGCGGGAACTCCAATAGAAGGGATGTTGCTAAAA
CGACAAAGTGGCGGCGGTTTCGTGTGGAGTGCTTCAATCATCTTTTGTGGCGTTTTGATAGGTTGCGGATCGATT
TGCATGACTATTTCAAGATTTCTTTACATTCGGAGTCGCCGAATCCATAAACAATGCGTATGA
Gene >AgabiH97|118830
ATGCAAAAGGTACAGACCTGACTTCGAGCACGACTGACGAGTGCTATGGAACTAGCCGAGGAAGCTCACTGGAAT
CGAAGGAAGCAGCCGAAGAATTTGAACCCAAGAAAGTCTGGCTCATCGCCCTTGCAACGTATGTATCATTGGTAG
TTCCAATGACCTCAAAGTTTAACTCTTCTACCAACTTAGATGGCTTGTGCAATTCTGTACTTATGGGTGTGTACT
CATCGCGCTAATTATCCCTGATTCGACATTCATCGCGTAAATGTTTCCACTAGCTATGTGTCGGCGTTTGGCGTC
TATCAAGACTATTACACCCGAGATTATTTGAGTGCAAGTACGCCGTCCGATATCAGGTGAGCATTCTTTTAGATA
TTGTCGTAGTGAGCATTCTATTAAGGGTGTTTTTCGCAGTTGGATAGGCAGCGTACAACTCTTCTTGCAGTATGC
CCTCGGGATTGTTGTCGGCAGGATATATGATCTCGGTTGGTTGTATGTCATATGTTATTCAAGGGTCTTTCGACG
TTCACAACTAAACGGGGCATCCCTATTCATATAGCCACCACTTGATTGGCGTGGGCACTGTCCTTCAAACTGTGT
CGTTGTTTATGCTTTCACTGACTCGCCGCCAACGCTATCCGGAGGTCAGTCTACTTTGCATTGGAATCAAACAAT
AAAATGAACCCTCCTTCTGTAGATTTTTCTCGCGCAAGCTATTGGCATGGGCCTAGGACAAGCGATGCTATTTTT
GCCTTCAATCACAGTGGTGTCGCACCATTTTAGAAGACGTAGGGTGGTGGCGACAGGTGTCGCGGTATCGGTATG
ATCCAATAATACTGAGACAGCACCCGAGCTAGATGAATATATCAGGGTGCTTCCGTAGGGGGTGTTATATGGCCG
ATTTTACTAAATCAGAGCAGCCAAGCATTGGGTTTTCCCAATGCCATTCGTATAACCGCGGCTCTCATCGGCGCT
TTCCTCCTCGTCGCGAATCTCCTTTACTTCATTGCGTGTTCAAGACCGACTTCTATCTCTTCTTCAACGTCCTTT
CAGAGTAGCAGACCAGACTTCCGAGCCATATTCACGGATGTTGCCTATTTGGTGTCTATCGCAGCGTGAGTGATT
ATGATCAGCTCTGCAGCGTTGGATTGATATCCTTAATAACCCCCTGAAATAGAGCGTTTTGTATCAATCTGGGAC
TATTCTTCCCATGTACGCCTTTGACATTCATGTGCCTCAGAACTCGGTGTTCATCTTTTTTCGTCTGGCGCCATG
CTCAGTCTTTTATCTACAATCGTATGCTCTTTCCGTGGGAATCAAATCTTCGCTTGCCTTTTATCTGGTATATTT
CCAAATTTCATCCCTTATCCGCCCCATTAAGTCTAATTTAAAAATGTTATCTTCTCTCAGTTGGCTATTTTGAAT
GGAGGCAGCGCGTTCGGACGTATCATTCCTAATATTCTAGCTGGAAAATTTGGGGTGTACAATACGTTACTTCCG
TCCCTCTACATCTCATCAGCGCTGGTCTTCGCTATCTTCGGCATTAAAAACTTCGCTGGCTTGACAATCTTCGCC
ATTCTATATGGATTTTGGTCTGGAGCATGTACGTCAAGATATCCTGTTTCTATCAGCTCGACTGCTTTTGCAAAA
ACTGATTTTTTTTTTCCAATGTTTACAAACAGATGTGTCCCTCATCCCTTCGTTACTCTGTCAACTTAGTCCTCA
CCCAAAAGAACTGGGGTAAGAGTTTGTATCAATCCTTGGTATGCGGGTGTTCTCATTCGATTAATGAAAAAGGGT
TCGCATGGGCATAGCATTCTCACTTGTGGCGATTTCCTTATTAGCGGGAACTCCAATAGAAGGGATGTTGCTAAA
ACGACAAAGTGGCGGCGGTTTCGTGTGGAGTGCTTCAATCATCTTTTGTGGCGTATGTGCTTAATATCCTATCCC
AGTCGACTCTTTCATAAGCTTTTCCAAAAGGTTTTGATAGGTTGCGGATCGATTTGCATGACTATTTCAAGATTT
CTTTACATTCGGAGTCGCCGAATCCATAAACAATGCGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail